In Silico B Cell and T Cell Epitopes Evaluation of lipL32 and OmpL1 Proteins for Designing a Recombinant Multi-Epitope Vaccine Against Leptospirosis

Author(s):
Narges NazifiNarges Nazifi1, Seyyed Mojtaba MousaviSeyyed Mojtaba Mousavi2, Saeedeh MoradiSaeedeh Moradi3, Amin JaydariAmin Jaydari4, Mohammad Hassan JahandarMohammad Hassan Jahandar5, Ali ForouharmehrAli Forouharmehr2,*
1Department of Animal Science, Faculty of Agriculture, Ferdowsi University of Mashhad, Mashhad, Iran
2Department of Animal Science, Faculty of Agriculture, Lorestan University, Khorramabad, Iran
3Department of Animal Science, Faculty of Agriculture, University of Tabriz, Tabriz, Iran
4Department of Microbiology, Faculty of Veterinary Medicine, Lorestan University, Khorramabad, Iran
5Department of Agriculture, Bam Branch, Islamic Azad University, Bam, IR Iran

International Journal of Infection:Vol. 5, issue 2; e63255
Published online:Apr 28, 2018
Article type:Research Article
Received:Oct 25, 2017
Accepted:May 02, 2018
How to Cite:Nazifi N, Mousavi SM, Moradi S, Jaydari A, Jahandar MH, et al. In Silico B Cell and T Cell Epitopes Evaluation of lipL32 and OmpL1 Proteins for Designing a Recombinant Multi-Epitope Vaccine Against Leptospirosis. Int J Infect. 2018;5(2):e63255. doi: https://doi.org/10.5812/iji.63255

Abstract

1. Background

Leptospirosis is a widespread zoonotic disease that could be found in both developed and developing countries. This disease is usually seen among mammalians (in particular, human, and livestock) that are in contact with rodents or living in polluted areas. There are more reports of this disease during unforeseen events such as floods, earthquakes, etc. (1-3). Leptospirosis is a bacterial disease caused by Leptospira interrogans. In fact, Leptospira genus is classified into Leptospira biflexa, which comprises all non-pathogenic strains, and Leptospira interrogans that consists of all pathogenic strains (4). Leptospirosis can be transferred through direct or indirect contact with the infected cases (5). The most prevalent symptoms of this disease are meningitis, hepatitis, and nephritis and sometimes, it leads to death (6, 7). Conventional vaccines (Bacterin -type) used to prevent Leptospirosis have some side effects (fever, pain), short-term immunity and serovar- resisted protection (4); hence, it is necessary to apply new strategies to solve these problems. One of the most recent strategies for preventing leptospirosis is to use recombinant vaccines that are epitope-based or protein vaccines with a vital role in antigenicity of a pathogen (8-10). Outer membrane proteins (OMPs) are the most important proteins diagnosed by the immune system in different bacterial infections. OMPs are widely applied to design recombinant vaccines such as subunit and epitope vaccines (4). There are three classes of OMPs in Leptospira: Lip (lipoprotein) that includes lipL32, lipL42, and lipL24; transmembrane proteins that include ompL1s, and finally peripheral proteins that include lipl42 (11-15). Many studies have shown that ompL1 and lipL32 are the most conserved OMPs in most pathogenic strains of Leptospira and they can be applied to design recombinant vaccines to prevent leptospirosis (16). Studies also showed that the application of an OMP as a subunit recombinant vaccine could not successfully prevent leptospirosis since it is not antigenic enough to stimulate the immune system. Consequently, it seems that applying multi-epitope vaccines, which use epitopes of several OMPs, is the solution to vaccine antigenicity (9, 17). Epitopes are amino acid sequences of OMPs recognized by antibodies of the immune system. In general, epitopes are divided into B cells (continuous and discontinuous) and T cells (MHCI and MHCII) (18, 19). Nowadays, by the progress in biological data, researchers are widely using intelligent methods such as machine learning for data analysis. Such methods not only are affordable, but also provide reliable data for the experiment (20). Therefore, in the present study, the most reliable and appropriate online tools and servers were applied to predict B cell and T cell epitopes of ompL1 and LipL32 (as the most important leptospirosis’ OMPs) (20).

2. Methods

To predict B and T cell epitopes of ompL1 (accession number: JX532100.1) and LipL32 (accession number: JN886739.1), their amino acid sequences were collected from the National Center for Biotechnology Information (NCBI).

2.1. B Cell Epitopes Prediction of Ompl1 and Lip32

In order to predict B cell epitopes of ompL1 and LipL32 using their primary amino acid sequences, the most reliable and accurate online servers were employed. These online servers include IEDB, ABCpred, BepiPred, BCPREDS, and SVMTrip. It must be noted that all servers have been designed to predict discontinuous B cell epitopes. Required parameters of each server such as the desired length to predict epitopes were adjusted as default (18).

2.2. T Cell Epitopes Prediction of Ompl1 and Lip32

In case of T cell epitopes prediction of ompL1 and LipL32, both MHCI and MHCII epitopes were evaluated by the most precise online servers: IEDB, SYFPEITH, NetCTL, NetMHC, Propred, and MHC2Pred (19).

2.3. Evaluation of the Most Important Features of the Predicted Epitopes

To investigate the antigenicity score of the predicted B and T cell epitopes, VaxiJen 2.0 server was employed with the desired threshold (0.5). Also, the most important features of the predicted epitopes such as enzymatic digestion sites, PI, and the Mass of the predicted epitopes through specialized servers were analyzed by Protein Digest server (18, 19).

2.4. Secondary and Tertiary Structure Prediction of ompL1 and Lip32

To predict secondary structures of ompL1 and LipL32 proteins, based on their primary amino acid sequences, improved self-optimized prediction method (SOPMA) server was applied and their helices, sheets, turns, and coil were evaluated. Tertiary structures of ompL1 and lipL32 proteins were designed by iterative threading assembly refinement (I-TASSER) online server which uses hierarchical approach to predict the structure and function of proteins. PDB formats of the predicted tertiary structures of the studied proteins were visualized by PyMOL V1 Viewer software (21).

3. Results

3.1. B Cell Epitopes Prediction of ompL1 and LipL32

As shown in Table 1, the initial results were theoretically obtained, based on the highest score and the most frequent epitopes among all the mentioned specialized servers. It must be mentioned that in order to predict discontinuous B cell epitopes, physic-chemical properties of amino acids such as hydrophilicity, charge, flexibility, polarity, and the exposed surface area were considered.
Table 1.The List of High Scored Predicted T Cell Epitopes Using Online Software and Their VaxiJen Scorea
SequenceServerSCOREVaxijen ScoreSequenceServerSCOREVaxijen Score
MHCI
LipL32OmpL1
63VKPGQAPDGLVDGNKKA79IEDB981.0042 (Probable ANTIGEN)72PACFQNPAKPTG83IEDB99NON-ANTIGEN
148IAKAAKAKPVQKLDDDDDGDDTYKEERHNK17799.51.2556 (Probable ANTIGEN)74CFQNPAKPTGEG85100NON-ANTIGEN
179 NSLTRIKIPNPPKS19298-0.1699 (Probable NON-ANTIGEN)202FNGGWSLNGSNN2131000.6696 (Probable ANTIGEN)
185 KIPNPPKSFDDLKN19897-0.3322 (Probable NON-ANTIGEN)109TGGAINARSTKG120992.2206 (Probable ANTIGEN)
98ISPTGEIGEPGDGDLVSDAFKAATPEEKSMPHWFD13295.870.4244 (Probable NON-ANTIGEN)258LIGTQARVTDKGH270950.9339 (Probable ANTIGEN)
152AKAKPVQKLDDDDDGDDTYKEERHNKYNS1701001.1642 (Probable ANTIGEN)67VGPSDPACFQNP78100NON-ANTIGEN
31 SSFVLSEDTIPGTNETVKT4996.250.5263 (ProbableANTIGEN)81PTGEGNYIGVAP92991.4730 (Probable ANTIGEN)
97MISPTGEIGEPGDGDLVSDA117990.4157 (ProbableNON-ANTIGEN)178PATVGIKLNVTE189991.6638 (Probable ANTIGEN)
153KAKPVQKLDDDDDGDDTYKEERHNK17799.881.2193 (ProbableANTIGEN)299PFPAYPIVVGGQ3101000.8669 (Probable ANTIGEN)
187 PNPPKSFDDLKNIDT201990.0200 (Probable NON-ANTIGEN)272FIELETIMSAAY283NetMHC0.4320.5005 (Probable ANTIGEN)
235PPGIPGVSPLIHSNPEELQKQAIAAEES26295.620.4033 (Probable NON-ANTIGEN)290SVGGATNLSPFPAY3030.3530.7905 (Probable ANTIGEN)
238IPGVSPLIHSNPEE2511000.5522 (Probable ANTIGEN)120GAMVGGNLMV1290.5130.8084 (Probable ANTIGEN)
34VLSEDTIPGTNETV47NetMHC0.537-0.3071 (Probable NON-ANTIGEN)231NLLSDGTDPV2400.649NON-ANTIGEN
76NKKAYYLYVWIPAV890.751-0.3071 (Probable NON-ANTIGEN)256NFLIGTQARV2650.594NON-ANTIGEN
80YYLYVWIPAVIAEM930.600-0.3071 (Probable NON-ANTIGEN)272FIELETIMSA2810.6680.5322 (Probable ANTIGEN)
207 RGLYRISFTTYKPG2200.4250.6082 (ProbableANTIGEN)296NLSPFPAYPI3050.5821.2997 (Probable ANTIGEN)
45ETVKTLLPY53NetCTL1.420.0981 (Probable NON-ANTIGEN)210GSNNIKGGY218NetCTL1.671.8330 (Probable ANTIGEN)
54GSVINYYGY621.24-0.1594 (Probable NON-ANTIGEN)265VTDKGHVFI2731.27NON-ANTIGEN
70DGLVDGNKKAYYLY83Syfpeithi170.3399 (Probable NON-ANTIGEN)274 ELETIMSAAY283Syfpeithi24NON-ANTIGEN
200DTKKLLVRGLY21024-0.3071 (Probable NON-ANTIGEN)294ATNLSPFPAY30323NON-ANTIGEN
142AIMPDQIAKA151250.4060 (Probable NON-ANTIGEN)176 VIPATVGIKLNVTEDAAI193221.1858 (Probable ANTIGEN)
203KLLVRGLYRI21226-0.5296 (Probable NON-ANTIGEN)92PRKAIPAENR10123NON-ANTIGEN
232LLFPPGIPGV241310.7159 (Probable ANTIGEN)141WRVAAEYTQK150240.9085 (Probable ANTIGEN)
248FRTSGIAPNF257Syfpeithi241.1327 (Probable ANTIGEN)
MHCII
64KPGQAPDGLVDGNKKAYY81IEDB89.970.7241 (Probable ANTIGEN)75FQNPAKPTGEGNYIGVAPR93IEDB91.610.7 (Probable ANTIGEN)
118KAATPEEKSMPHWFDTW134IEDB92.650.2905 (Probable NON-ANTIGEN)233LSDGTDPVTTREHVRFRTS251IEDB85.641.1127 (Probable ANTIGEN)
186IPNPPKSFDDLKNID200-0.0292 (Probable NON-ANTIGEN)59VRSSNTCTV67Propred3.41.4325 (Probable ANTIGEN)
99SPTGEIGEPGDGDLVSD11583.370.4243 (Probable NON-ANTIGEN)183IKLNVTEDA1914.10.9238 (Probable ANTIGEN)
150KAAKAKPVQKLDDDDDGDDTYKEER17483.581.1462 (Probable ANTIGEN)218YDILTAAGA2261.1NON-ANTIGEN
82YVWIPAVIA90Propred551.1663 (Probable ANTIGEN)272FIELETIMS2803.380.5775 (Probable ANTIGEN)
177YNSLTRIKI18523.330.1128 (Probable NON-ANTIGEN)142RVAAEYTQK150MHC2Pred1.5280.8696 (Probable ANTIGEN)
229VGLLFPPGI23732.830.2905 (Probable NON-ANTIGEN)155VTKADIAGY1631.0090.6261 (Probable ANTIGEN)
22FGGLPSLKS3045.350.4137 (Probable NON-ANTIGEN172SIVIPATVG1821.793NON-ANTIGEN
33VLSEDTIPG4131.160.0022 (Probable NON-ANTIGEN)227GAVANLLSD2351.431NON-ANTIGEN
82YVWIPAVIA9034.651.1663 (Probable ANTIGEN)257FLIGTQARV2651.5070.5925 (Probable ANTIGEN)
209YRISFTTYK21769.770.7222 (Probable ANTIGEN)290SVGGATNLS2981.4640.9973 (Probable ANTIGEN)
83YVWIPAVIA41MHC2Pred1.6071.1663 (Probable ANTIGEN)103ITLDRTTGG1111.1051.5169(Probable ANTIGEN)
88AVIAEMGVR961.520.8893 (Probable ANTIGEN)
136RVERMSAIM1441.65-0.4057 (Probable NON-ANTIGEN)
115DAFKAATPE1431.4060.8056 (Probable ANTIGEN)
130WFDTWIRVE1380.0030 (Probable NON-ANTIGEN)
138ERMSAIMPD1460.2385 (Probable NON-ANTIGEN)

aHighlight parts related to selected epitopes with more than 0.5 score of VaxiJen for digestion analysis.

3.2. T Cell Epitopes Prediction of ompL1 and LipL32

To predict T cell epitopes, the most frequent Iranian alleles of MHCI (A-0101, A0201, and B-2705) and MHCII (DRB1-0101 and DRB1-0401) were used. It must be mentioned that in each server, the predicted epitopes with the highest scores were selected (data not shown). Then, T cell predicted epitopes were evaluated using the above mentioned servers and used in the following analysis in order to identify the conserved sequences in both MHCI and MHCII epitopes (Table 2).
Table 2.The List of High Scored Predicted B Cell Epitopes Using Online Software and Their VaxiJen Scorea
SequenceServerSCOREVaxiJen ScoreSequenceServerSCOREVaxiJen Score
LipL32OmpL1
119AATPEEKS126IEDB1.3680.9680 (ProbableANTIGEN)45ITKDGLDAATHYGPVRSS62IEDB0.816NON-ANTIGEN
158QKLDDDDDGDDTYKEE1731.7621.5742 (Probable ANTIGEN)66TVGPSDPACFQNPAKPTGEGN861.46NON-ANTIGEN
137VEERMSAIMPDQIAKA152ABCpred0.90.2977 (Probable NON-ANTIGEN)141WRVAAEYTQKISGG154ABCpred0.881.0726 (Probable ANTIGEN)
127MPHWFDTWIRVEERMS1420.770.3736 (Probable NON-ANTIGEN)213NIKGGYDILTAAGAGAVANL2320.840.8346 (Probable ANTIGEN)
144MPDQIAKAAKAKPV1570.910.3754 (Probable NON-ANTIGEN)89GVAPRKAIPAENRLITLDRTTG1100.78-0.1147 (Probable NON-ANTIGEN)
63VKPGQAPDGLVD74BepiPred1.391.1553 (Probable ANTIGEN)34LQLDLGQLGGTITK47BCPREDS (BCPred)0.9770.5749 (Probable ANTIGEN)
102GEIGEPGDGDL1121.710.8654 (Probable ANTIGEN)53ATHYGPVRSSNTCTVGPSDP72BCPREDS (AAP)10.8607 (Probable ANTIGEN)
117FKAATPEEKSMP1281.110.2487 (Probable NON-ANTIGEN)103ITLDRTTGGAINARSTKGAM12211.4181 (Probable ANTIGEN)
230VGLLFPPGIPGVSPLIHSNP249BCPREDS (BCPred)10.3560 (Probable NON-ANTIGEN)130GYESDFGKYFFWRVAAEYTQ1490.973NON-ANTIGEN
39TIPGTNETVKTLLPYGSVIN58BCPREDS (AAP)10.0138 (Probable NON-ANTIGEN)165IVDMTWGFSSIVIPATVGIK16410.7011 (Probable ANTIGEN)
107PGDGDLVSDAFKAATPEEKS12610.8044 (Probable ANTIGEN)202FNGGWSLNGSNNIKGGYDIL2210.9790.9594 (Probable ANTIGEN)
184IKIPNPPKSFDDLKNIDTKK20310.2565 (Probable NON-ANTIGEN)223AAGAGAVANLLSDGTDPVTT2421NON-ANTIGEN
58NYYGYVKPGQAPDG71BCPREDS (FBCPred)0.9990.5762 (Probable ANTIGEN)288TQSVGGATNLSPFPAYPIVV30711.1034 (Probable ANTIGEN)
100PTGEIGEPGDGDLV11210.6637 (Probable ANTIGEN)227FIELETIMSAAYAVGKTQSV291SVMTrip10.5332 (Probable ANTIGEN)
47VKTLLPYGSVINYYGYVKPG66SVMTrip1.000-0.3640 (Probable NON-ANTIGEN)

aHighlight areas related to selected epitopes with more than 0.5 score of VaxiJen for digestion analysis.

3.3. Evaluation of the Most Important Features of Predicted Epitopes

After prediction of B cell and T ell epitopes using out put of different online servers, their antigenicity scores were evaluated, as shown in Tables 1 and 2. Epitopes with a score above 0.5 were considered as the most antigenic epitopes. The obtained results from this step were applied in further study to evaluate the enzymatic digestion. PI and Mass, reported in Table 3, were calculated by protein digestion server. According to these results, the antigenic epitopes that had the largest number of non-digestive enzymes were selected as final B cell and T cell epitopes (Table 3) (colored epitopic regions indicate the selected ones). Epitopes with the same caption are common among different categories (Table 4). In the case of ompL1 protein, pink, green, and red regions are common between T Cell (MHCI) or B Cell epitopes, but the blue color is common among both T and B cells that are arranged between 288 and 307aa residues (Table 3). Finally, those selected sequences from lipL32 protein have the gray colored in both T cell categories (MHCI & MHCII), which are located at 80 - 93aa residues. Moreover, the blue regions indicate common epitopes between both T (MHCI & MHCII) and B cells and are located at an amino acid range of 64 - 81 (Table 3).
Table 3.Protein Digestion Analysis of Final B- and T-Cell Epitopesa
SequencePIMassNon-Digestive EnzymeSequencePIMassNon-Digestive Enzyme
T Cell, MHCI
OmpL1LipL32
210GSNNIKGGY2188.59908.97Chymotrypsin, Clostripain, Cyanogen_Bromide, Proline_Endopept, Staph_Protease, IodosoBenzoate, Trypsin_R, AspN , Chymotrypsin (modified)31SSFVLSEDTIPGTNETVK484.141924.09Trypsin,Clostripain, Cyanogen_Bromide, IodosoBenzoate, Trypsin_K,Trypsin_R,
272FIELETIMSAAY2833.791387.61Trypsin, Chymotrypsin, Clostripain, IodosoBenzoate, Proline_Endopept, Trypsin_K, Trypsin_R, AspN,63 VKPGQAPDGLVDGNKKA798.471693.92Chymotrypsin,Clostripain, Cyanogen_Bromide,IodosoBenzoate, Staph_Protease,Trypsin_R,
290SVGGATNLSPFPAY3035.241380.52Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Staph_Protease,Trypsin_K, Trypsin_R, AspN,76 NKKAYYLYVWIPAV899.401728.07Clostripain, Cyanogen_Bromide, Staph_Protease, Trypsin_R,AspN,
109TGGAINARSTKG12011.001132.24Chymotrypsin, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, AspN, Chymotrypsin (modified),80YYLYVWIPAVIAEM934.001731.08Trypsin, Clostripain,Cyanogen_Bromide, Trypsin_K,Trypsin_R, AspN
81PTGEGNYIGVAP924.001077.16Trypsin, Cyanogen_Bromide, Clostripain, IodosoBenzoate, Trypsin_K, Trypsin_R,AspN,153 KAKPVQKLDDDDDGDDTYKEERHNK1774.702960.12Cyanogen_Bromide, IodosoBenzoate
178PATVGIKLNVTE1896.641241.45Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Staph_Protease, Trypsin_R, AspN207 RGLYRISFTTYKPG22010.281658.92Cyanogen_Bromide, IodosoBenzoate
248 FRTSGIA PNF2579.751109.25Cyanogen_Bromide, Trypsin_K, AspN, IodosoBenzoate, Staph_Protease,232 LLFPPGIPGV2415.521009.26Trypsin ,Chymotrypsin, Clostripain,Cyanogen_Bromide,IodosoBenzoate, Staph_Protease,Trypsin_K, Trypsin_R, AspN
238IPGVSPLIHSNPEE2514.811488.66Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate,Trypsin_K, Trypsin_R, AspN,
31SSFVLSEDTIPGTNETVK484.141924.09Trypsin,Clostripain, Cyanogen_Bromide, IodosoBenzoate, Trypsin_K,Trypsin_R,
T Cell, MHCII
OmpL1LipL32
103ITLDRTTGG1115.84933.03Chymotrypsin, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease,Trypsin_K,64KPGQAPDGLVDGNKKAY818.431757.96Clostripain, Cyanogen_Bromide, IodosoBenzoate, Staph_Protease, Trypsin_R,
142RVAAEYTQK1508.591065.19Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Trypsin_K, AspN83YVWIPAVIA915.521031.26Trypsin, Clostripain, Cyanogen_Bromide, Staph_Protease, Trypsin_K, Trypsin_R, AspN,
75FQNPAKPTGEGNYIGVAPR938.592016.24Trypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate,Trypsin_K, Trypsin_R, AspN88AVIAEMGVR966.05945.14Trypsin, Chymotrypsin, Clostripain, IodosoBenzoate, Proline_Endopept, Trypsin_K, Trypsin_R, AspN, Chymotrypsin(modified),
155VTKADIAGY1635.81937.06Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, Trypsin_R, Chymotrypsin (modified)115DAFKAATPE4.75949.03Cyanogen_Bromide, IodosoBenzoate, Staph_Protease, Trypsin_R, AspN,
183IKLNVTEDA1934.371002.13Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Trypsin_R150KAAKAKPVQKLDDDDDGDDTYKE1724.492565.73Clostripain, Cyanogen_Bromide, IodosoBenzoate, Staph_Protease,Trypsin_R,
233LSDGTDPVTTREHVRFRTS2516.762174.36Cyanogen_Bromide, IodosoBenzoate, Trypsin_K209YRISFTTYK2179.701178.35Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, Trypsin_K, AspN,
290SVGGATNLS2985.24804.86Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, Trypsin_K, Trypsin_R, AspN
B Cell
OmpL1LipL32
34LQLDLGQLGGTITK475.841456.70Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, Trypsin_K,Trypsin_R58 NYYGYVKPGQAPDG715.831528.64Trypsin, Clostripain, Cyanogen_Bromide,IodosoBenzoate,Staph_Protease, Trypsin_K, Trypsin_R,
29ATHYGPVRSSNTCTVGPSDP486.792046.20Cyanogen_Bromide, IodosoBenzoate, Staph_Protease, Trypsin_K63VKPGQAPDGLVD744.541195.34Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Staph_Protease, Trypsin_K, Trypsin_R,
103ITLDRTTGGAINARSTKGAM12210.841987.22Chymotrypsin, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease100PTGEIGEPGDGDL1123.431256.29Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Trypsin_K,Trypsin_R, Chymotrypsin(modified)
165IVDMTWGFSSIVIPATVGIK1845.842134.56Trypsin, Clostripain, Staph_Protease, Trypsin_K, Trypsin_R119 AATPEEKS1264.53831.88Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Trypsin_R, AspN, Chymotrypsin(modified),
202FNGGWSLNGSNNIKGGYDIL2215.832126.31Clostripain, Cyanogen_Bromide, Proline_Endopept, Staph_Protease, Trypsin_R158QKLDDDDDGDDTYKE1723.851771.72Clostripain, Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, Trypsin_R,
213NIKGGYDILTAAGAGAVANL2325.831889.14Cyanogen_Bromide, IodosoBenzoate, Proline_Endopept, Staph_Protease, Trypsin_K,Trypsin_R,
272FIELETIMSAAYAVGKTQSV2914.532158.49Clostripain, IodosoBenzoate, Proline_Endopept, Trypsin_R, AspN,
288TQSVGGATNLSPFPAYPIVV3075.182018.30Trypsin, Chymotrypsin, Clostripain, Cyanogen_Bromide, IodosoBenzoate, Staph_Protease, Trypsin_K, Trypsin_R, AspN

aAll colored epitopes related to final selected epitopes with maximum of Non-digestive enzymes; ompL1 protein: pink, green and red region are common epitopes between T cell MHCI class and B cell epitopes but the blue one is the common epitopes among both T and B cells which arranged between 288-307 amino acid residuals. LipL32 protein; gray colored epitopes are common ones among the T cell epitopes and located in 80-93 amino acid residuals. And the blue ones indicate the common ones between both T and B cell epitopes and are in amino acid 64-81 residuals.

Table 4.Final B and T Cell Predicted Epitopesa
OMPL1lip32
T Cell (MHCI)
109TGGAINARSTKG120-
210GSNNIKGGY21863VKPGQAPDGLVDGNKKA79
272FIELETIMSAAY28380YYLYVWIPAVIAEM93
290SVGGATNLSPFPAY303238IPGVSPLIHSNPEE251
T Cell (MHCII)
75FQNPAKPTGEGNYIGVAPR9364KPGQAPDGLVDGNKKAY81
155VTKADIAGY16388AVIAEMGVR96
290SVGGATNLS298209YRISFTTYK217
B Cell
34LQLDLGQLGGTITK4763VKPGQAPDGLVD74
103ITLDRTTGGAINARSTKGAM122100PTGEIGEPGDGDL112
213NIKGGYDILTAAGAGAVANL232-
272FIELETIMSAAYAVGKTQSV291-
288TQSVGGATNLSPFPAYPIVV307-

aIn first column; green, pink and red highlighted regions related to common epitopes between T cell MHCI class and B cell, and the blue ones related to the common ones among both T and B cells. In second column; the gray epitopes are common between MCHI and MHCII classes and the blue highlighted epitopes are common epitopes among both T and B cells

3.4. Secondary and Tertiary Structure Prediction of ompl1 and Lip32

As reported earlier, in order to predict the secondary structure of candidate proteins, SOPMA server was applied. OmpL1 protein included 23.79% Alpha helix, 38.26% Random coil, 27.33% Extended strand, and 10.61% Beta-turn structures (Figure 1). In addition, lipL32 protein included 38.06% Alpha helix, 19.03% Extended strand, 9.33% Beta-turn, and 33.58% Random coil structures (Figure 2). As shown in the results, these two proteins involved a high proportion of random coil structures indicating the concentration of epitopes in the mentioned areas, rather than total protein. The results of the 3DLigandSite show that all the final predicted B and T cell epitopes of ompL1 and lipL32 can be exposed on the surfaces (Figure 3A and 3B).
Secondary structure prediction results of OMPL protein. Amino acids with different colors represent different secondary structures. Blue: α helix, green: β turn, red: extended strand, and yellow: random coil.
Figure 1.

Secondary structure prediction results of OMPL protein. Amino acids with different colors represent different secondary structures. Blue: α helix, green: β turn, red: extended strand, and yellow: random coil.

Secondary structure prediction results of Lip32 protein. Amino acids with different colors represent different secondary structures. Blue: α helix, green: β turn, red: extended strand, and yellow: random coil.
Figure 2.

Secondary structure prediction results of Lip32 protein. Amino acids with different colors represent different secondary structures. Blue: α helix, green: β turn, red: extended strand, and yellow: random coil.

Tertiary structure prediction results for the OMPL1 (A) and Lip32 (B) proteins. A: green, pink, and red highlighted regions related to common epitopes between T cell MHCI class and B cell, and the blue ones related to the common ones among T and B cells. B: the gray regions are common between T cell MCHI and MHCII classes and the blue highlighted regions are common epitopes among both T and B cells.
Figure 3.

Tertiary structure prediction results for the OMPL1 (A) and Lip32 (B) proteins. A: green, pink, and red highlighted regions related to common epitopes between T cell MHCI class and B cell, and the blue ones related to the common ones among T and B cells. B: the gray regions are common between T cell MCHI and MHCII classes and the blue highlighted regions are common epitopes among both T and B cells.

4. Discussion

Vaccines prevent infectious diseases. Although conventional vaccines (attenuated and killed vaccines) are able to save millions of lives, there are some drawbacks such as long production process (around 15 years), the diverse effects on different cases, and their side effects (even death) (22-24). Therefore, it seems that the new generation of vaccines must be substituted with the conventional ones. Today, bioinformatics is widely being used. In fact, bioinformatics uses both computer and biology to accelerate data analysis and decrease the expenditure of the experiments. One of the most important applications of bioinformatics is vaccine production. In fact, advancements in bioinformatics tools along with the advances in recombinant DNA technology and genetics can decrease the time (around 2 years) and expenses of vaccine production (20, 25). As noted before, since Leptospirosis is a zoonotic and widespread disease in most developing countries including Iran, certain considerations should be taken into account to fight this disease. Many studies have reported that subunit recombinant vaccines, which have been designed based on LipL32 and ompL1 proteins (as the most important OMPs to design subunit vaccine), cannot be successfully applied to treat Leptospirosis, because these recombinant vaccines are not strong enough to stimulate the immune system against the disease (16, 26). However more recently, it has been reported that the use of chimeric epitope vaccines designed based on epitopes of OmpL1 and Lep32 is a promising method of fighting leptospirosis (16). Therefore, it seems in order to produce chimeric epitope vaccine, the epitope prediction of ompL1 and LipL32 for Leptospirosis is of great importance. In this study, the most accurate and reliable bioinformatics tools were applied to predict B cell and T cell epitopes of ompL1 and LipL32 (18-20). As our result showed, 20 to 25 amino acids, at the beginning of both proteins, cannot be epitopes because these amino acid sequences are usually considered as a signal peptide to translocate proteins to the endoplasmic reticulum and they are then cleaved by signal peptidase (27, 28). Therefore, these amino acid sequences cannot be exposed as epitopes on the surface of the bacteria to stimulate the immune system.
The results of the current study obviously showed that the epitopic region of ompL1 protein including 103 - 122, 210 - 232, and 272 - 291 aa residues are the most common epitopes between T cell (MHCI) and B cell. In addition, 288-308 aa residues could be considered as a unique epitopic region to stimulate both T cell (MHCI&MHCII) and B cell. Moreover, the amino acids that have been arranged in 80 - 96aa residues are recommended for T cell epitope and 63 - 8196aa residues are suggested for both B and T cells in LipL32 protein. All of them can be considered to design a chimerical epitopic vaccine.
According to our prediction, it appears these epitopes could not only evade from protease system but also provide enough immune response against Leptospirosis. In fact, the evasion of protease system can increase epitopes half-life and can lead to the stimulation of immune system. It should be noted that the final epitopes, which have been predicted in this study, could simultaneously stimulate B and T cells. Therefore, the use of these epitopes with the appropriate arrangement could lead to a proper immune response.

4.1. Conclusions

Nowadays, bioinformatics is widely being used to analyze biological data. This area of science can accelerate data analysis and decrease the expenses at the same time. In this study, a wide variety of the most reliable and precise online tools and servers were applied to predict B cell, T cell, and common B and T cell epitopes of ompL1 and lipL32. In addition, 288 - 308aa residues of ompL1 protein can be considered as common epitopes to stimulate both T cell (MHCI and MHCII) and B cell. For LipL32 protein, 63-81aa residues are suggested for the epitopic region of both B and T cells. However, the results of this study need to be confirmed by further experimental studies.

Footnotes

References

  • 1.
    Adler B, de la Pena Moctezuma A. Leptospira and leptospirosis. Vet Microbiol. 2010;140(3-4):287-96. [PubMed ID: 19345023]. https://doi.org/10.1016/j.vetmic.2009.03.012.
  • 2.
    Bharti AR, Nally JE, Ricaldi JN, Matthias MA, Diaz MM, Lovett MA, et al. Leptospirosis: a zoonotic disease of global importance. Lancet Infect Dis. 2003;3(12):757-71. [PubMed ID: 14652202].
  • 3.
    Felix SR, Hartwig DD, Argondizzo AP, Silva EF, Seixas FK, Neto AC, et al. Subunit approach to evaluation of the immune protective potential of leptospiral antigens. Clin Vaccine Immunol. 2011;18(12):2026-30. [PubMed ID: 22030369]. https://doi.org/10.1128/CVI.05297-11.
  • 4.
    Dellagostin OA, Grassmann AA, Hartwig DD, Felix SR, da Silva EF, McBride AJ. Recombinant vaccines against leptospirosis. Hum Vaccin. 2011;7(11):1215-24. [PubMed ID: 22048111]. https://doi.org/10.4161/hv.7.11.17944.
  • 5.
    Levett PN. Leptospirosis. Clin Microbiol Rev. 2001;14(2):296-326. [PubMed ID: 11292640]. https://doi.org/10.1128/CMR.14.2.296-326.2001.
  • 6.
    de Souza AL, Sztajnbok J, Marques SR, Seguro AC. Leptospirosis-induced meningitis and acute renal failure in a 19-month-old male child. J Med Microbiol. 2006;55(Pt 6):795-7. [PubMed ID: 16687602]. https://doi.org/10.1099/jmm.0.46486-0.
  • 7.
    Dolhnikoff M, Mauad T, Bethlem EP, Carvalho CR. Leptospiral pneumonias. Curr Opin Pulm Med. 2007;13(3):230-5. [PubMed ID: 17414132]. https://doi.org/10.1097/MCP.0b013e3280f9df74.
  • 8.
    Cullen PA, Cordwell SJ, Bulach DM, Haake DA, Adler B. Global analysis of outer membrane proteins from Leptospira interrogans serovar Lai. Infect Immun. 2002;70(5):2311-8. [PubMed ID: 11953365].
  • 9.
    Haake DA, Mazel MK, McCoy AM, Milward F, Chao G, Matsunaga J, et al. Leptospiral outer membrane proteins OmpL1 and LipL41 exhibit synergistic immunoprotection. Infect Immun. 1999;67(12):6572-82. [PubMed ID: 10569777].
  • 10.
    Seixas FK, Fernandes CH, Hartwig DD, Conceicao FR, Aleixo JA, Dellagostin OA. Evaluation of different ways of presenting LipL32 to the immune system with the aim of developing a recombinant vaccine against leptospirosis. Can J Microbiol. 2007;53(4):472-9. [PubMed ID: 17612601]. https://doi.org/10.1139/w06-138.
  • 11.
    Cullen PA, Haake DA, Bulach DM, Zuerner RL, Adler B. LipL21 is a novel surface-exposed lipoprotein of pathogenic Leptospira species. Infect Immun. 2003;71(5):2414-21. [PubMed ID: 12704111].
  • 12.
    Dong H, Hu Y, Xue F, Sun D, Ojcius DM, Mao Y, et al. Characterization of the ompL1 gene of pathogenic Leptospira species in China and cross-immunogenicity of the OmpL1 protein. BMC Microbiol. 2008;8:223. [PubMed ID: 19087358]. https://doi.org/10.1186/1471-2180-8-223.
  • 13.
    Haake DA, Chao G, Zuerner RL, Barnett JK, Barnett D, Mazel M, et al. The leptospiral major outer membrane protein LipL32 is a lipoprotein expressed during mammalian infection. Infect Immun. 2000;68(4):2276-85. [PubMed ID: 10722630].
  • 14.
    Matsunaga J, Young TA, Barnett JK, Barnett D, Bolin CA, Haake DA. Novel 45-kilodalton leptospiral protein that is processed to a 31-kilodalton growth-phase-regulated peripheral membrane protein. Infect Immun. 2002;70(1):323-34. [PubMed ID: 11748198].
  • 15.
    Shang ES, Summers TA, Haake DA. Molecular cloning and sequence analysis of the gene encoding LipL41, a surface-exposed lipoprotein of pathogenic Leptospira species. Infect Immun. 1996;64(6):2322-30. [PubMed ID: 8675344].
  • 16.
    Lin X, Xiao G, Luo D, Kong L, Chen X, Sun D, et al. Chimeric epitope vaccine against Leptospira interrogans infection and induced specific immunity in guinea pigs. BMC Microbiol. 2016;16(1):241. [PubMed ID: 27737644]. https://doi.org/10.1186/s12866-016-0852-y.
  • 17.
    Branger C, Sonrier C, Chatrenet B, Klonjkowski B, Ruvoen-Clouet N, Aubert A, et al. Identification of the hemolysis-associated protein 1 as a cross-protective immunogen of Leptospira interrogans by adenovirus-mediated vaccination. Infect Immun. 2001;69(11):6831-8. [PubMed ID: 11598056]. https://doi.org/10.1128/IAI.69.11.6831-6838.2001.
  • 18.
    Forouharmehr A, Nassiry MR. B and T-cell epitopes prediction of the P40 antigen for developing mycoplasma agalactiae vaccine using Bioinformatic Tools. Genet Millennium. 2015;13(1):3954-61.
  • 19.
    Yousefi S, Tahmoorespur M, Sekhavati MH. B and T‐Cell epitope prediction of the OMP25 antigen for developing Brucella melitensis vaccines for sheep. Iran J Appl Animal Sci. 2015;5.
  • 20.
    Soria-Guerra RE, Nieto-Gomez R, Govea-Alonso DO, Rosales-Mendoza S. An overview of bioinformatics tools for epitope prediction: implications on vaccine development. J Biomed Inform. 2015;53:405-14. [PubMed ID: 25464113]. https://doi.org/10.1016/j.jbi.2014.11.003.
  • 21.
    Wass MN, Kelley LA, Sternberg MJ. 3DLigandSite: predicting ligand-binding sites using similar structures. Nucleic Acids Res. 2010;38(Web Server issue):W469-73. [PubMed ID: 20513649]. https://doi.org/10.1093/nar/gkq406.
  • 22.
    Arinaminpathy N, Ratmann O, Koelle K, Epstein SL, Price GE, Viboud C, et al. Impact of cross-protective vaccines on epidemiological and evolutionary dynamics of influenza. Proc Natl Acad Sci U S A. 2012;109(8):3173-7. [PubMed ID: 22323589]. https://doi.org/10.1073/pnas.1113342109.
  • 23.
    Jarzab A, Skowicki M, Witkowska D. [Subunit vaccines--antigens, carriers, conjugation methods and the role of adjuvants]. Postepy Hig Med Dosw (Online). 2013;67:1128-43. [PubMed ID: 24379254].
  • 24.
    Olson JK, Croxford JL, Calenoff MA, Dal Canto MC, Miller SD. A virus-induced molecular mimicry model of multiple sclerosis. J Clin Invest. 2001;108(2):311-8. [PubMed ID: 11457884]. https://doi.org/10.1172/JCI13032.
  • 25.
    Jackwood MW, Hickle L, Kapil S, Silva R, Osterrieder K, Prideaux C, et al. Vaccine development using recombinant DNA technology. Council Agric Sci Technol. 2008;38:1-11.
  • 26.
    Koizumi N, Watanabe H. Leptospirosis vaccines: past, present, and future. J Postgrad Med. 2005;51(3):210-4. [PubMed ID: 16333195].
  • 27.
    de Marco A. Strategies for successful recombinant expression of disulfide bond-dependent proteins in Escherichia coli. Microb Cell Fact. 2009;8:26. [PubMed ID: 19442264]. https://doi.org/10.1186/1475-2859-8-26.
  • 28.
    Zamani M, Nezafat N, Negahdaripour M, Dabbagh F, Ghasemi Y. In Silico Evaluation of Different Signal Peptides for the Secretory Production of Human Growth Hormone in E. coli. Int J Peptide Res Ther. 2015;21(3):261-8. https://doi.org/10.1007/s10989-015-9454-z.

Similar Articles

1
Dec
2020
Int J Infect

Introduction of a Novel Poly-Epitope Vaccine Against Mycobacterium tuberculosis Infection; an Immunoinformatics Approach

Ehsan Rashidian,
Ali Forouharmehr,
Amin Jaydari

Rashidian E, Forouharmehr A, Jaydari A. Introduction of a Novel Poly-Epitope Vaccine Against Mycobacterium tuberculosis Infection; an Immunoinformatics Approach. Int J Infect. 2020;8(1):e110423. doi: https://doi.org/10.5812/iji.110423

15
Nov
2017

Construction of a Recombinant OmpC Dominant Epitope-Based Vaccine Against Escherichia coli and Evaluation of Its Immunogenicity and Protective Immunity

Xiang Liu,
Chunlin Chen,
Chen Chen,
Rui Ding,
Gregory Marslin

Liu X, Chen C, Chen C, Ding R, Marslin G. Construction of a Recombinant OmpC Dominant Epitope-Based Vaccine Against Escherichia coli and Evaluation of Its Immunogenicity and Protective Immunity. Jundishapur J Microbiol. 2017;10(11):e55652. doi: https://doi.org/10.5812/jjm.55652

6
Feb
2017

Designing a Novel Multi-epitope DNA- Based Vaccine Against Tuberculosis: In Silico Approach

Jale Moradi,
Mina Tabrizi,
Maryam Izad,
Nader Mosavari,
Mohammad Mehdi Feizabadi

Moradi J, Tabrizi M, Izad M, Mosavari N, Feizabadi MM. Designing a Novel Multi-epitope DNA- Based Vaccine Against Tuberculosis: In Silico Approach. Jundishapur J Microbiol. 2017;10(3):e67156. doi: https://doi.org/10.5812/jjm.43950

1
Jun
2014

In Silico Identification and Conservation Analysis of B-cell and T-Cell Epitopes of Hepatitis C Virus 3a Genotype Enveloped Glycoprotein 2 From Pakistan: A Step Towards Heterologous Vaccine Design

Aqsa Ikram,
Sadia Anjum,
Muhammad Tahir

Ikram A, Anjum S, Tahir M. In Silico Identification and Conservation Analysis of B-cell and T-Cell Epitopes of Hepatitis C Virus 3a Genotype Enveloped Glycoprotein 2 From Pakistan: A Step Towards Heterologous Vaccine Design. Hepat Mon. 2014;14(6):e9832. doi: https://doi.org/10.5812/hepatmon.9832

14
Oct
2014

Immunogenicity of Multi-Epitope DNA and Peptide Vaccine Candidates Based on Core, E2, NS3 and NS5B HCV Epitopes in BALB/c Mice

Leila Pishraft Sabet,
Tahereh Taheri,
Arash Memarnejadian,
Talat Mokhtari Azad,
Fatemeh Asgari,
Ramin Rahimnia
,et al.

Pishraft Sabet L, Taheri T, Memarnejadian A, Mokhtari Azad T, Asgari F, et al. Immunogenicity of Multi-Epitope DNA and Peptide Vaccine Candidates Based on Core, E2, NS3 and NS5B HCV Epitopes in BALB/c Mice. Hepat Mon. 2014;14(10):22215. doi: https://doi.org/10.5812/hepatmon.22215


Crossmark
Crossmark
Checking
Share on
Cited by
Metrics

Ordering Reprints

Articles are published under the Creative Commons license stated on each article. No permission or royalty fee is required for uses permitted by that license. CCC handles optional bulk and customized reprint orders. Any quotation covers production and delivery services only, not copyright permission. > Request Reprints from CCC 

Search Relations

Author(s):

Related Articles