Iran J Pharm Res

Image Credit:Iran J Pharm Res

In Silico Analyses of Extracellular Proteins of Acinetobacter baumannii as Immunogenic Candidates

Author(s):
Sepideh FereshtehSepideh Fereshteh1, Narjes Noori GoodarziNarjes Noori Goodarzi2, Amin SepehrAmin Sepehr1, Morvarid ShafieiMorvarid Shafiei1, Soheila AjdarySoheila Ajdary3, Farzad BadmastiFarzad Badmasti1,*
1Department of Bacteriology, Pasteur Institute of Iran, Tehran, Iran
2Department of Pathobiology, Tehran University of Medical Sciences, Tehran, Iran
3Department of Immunology, Pasteur Institute of Iran, Tehran, Iran

IJ Pharmaceutical Research:Vol. 21, issue 1; e126559
Published online:May 09, 2022
Article type:Research Article
Received:Jun 15, 2021
Accepted:Aug 17, 2021
How to Cite:Fereshteh S, Noori Goodarzi N, Sepehr A, Shafiei M, Ajdary S, et al. In Silico Analyses of Extracellular Proteins of Acinetobacter baumannii as Immunogenic Candidates. Iran J Pharm Res. 2022;21(1):e126559. doi: https://doi.org/10.5812/ijpr-126559

Abstract

Background:

Acinetobacter baumannii is an important nosocomial pathogen causing high morbidity and mortality in immunocompromised patients with prolonged hospitalization. Multidrug-resistant A. baumannii infections are on the rise worldwide. Therefore, the discovery of an effective vaccine against this bacterium seems necessary as a cost-effective and preventive strategy.

Methods:

In this present study, 35 genomes of A. baumannii strains were considered, and the extracellular proteins were selected, maximally having one transmembrane helix with high adhesion probability and no similarity to host proteins, as immunogenic candidates using the web tool Vaxign. Subsequently, the role of these selected proteins in bacterial pathogenesis was investigated using VICMpred. Then, the major histocompatibility complex class II, linear B-cell epitopes, and conservation of epitopes were identified using the Immune Epitope Database, BepiPred, and Epitope Conservancy Analysis, respectively. Finally, the B-cell discontinuous epitopes of each protein were predicted using ElliPro and plotted on the three-dimensional structure (3D) of the proteins. The role of the unknown proteins was predicted using the STRING database.

Results:

In this study, eight acceptable immunogenic candidates, including FilF, FimA, putative acid phosphatase, putative exported protein, subtilisin-like serine protease, and three uncharacterized proteins, were identified in A. baumannii.

Conclusions:

The results of the STRING database showed that these three uncharacterized proteins play a role in nutrition (heme utilization), peptide bond cleavage (serine peptidases), and cellular processes (MlaD protein). Extracellular proteins might play a catalyst role in the outer membrane protein-based vaccine of A. baumannii. Furthermore, this study proposed a list of potent immunogenic candidates of extracellular proteins.

1. Background

Acinetobacter baumannii, as a nosocomial pathogen, causes various infections in different anatomical sites of the human body, such as skin, bloodstream, and urinary tract, with high mortality and morbidity rates (1, 2). This bacterium has a high incidence in immunocompromised individuals, especially those who have had a prolonged (≥ 90 days) hospital stay (3). Although this Gram-negative coccobacillus was considered a low-grade pathogen in the past, it has become a major public health concern nowadays due to its high resistance to most clinically available antibiotics. In recent years, various strategies, including vaccination (4), monoclonal antibodies (5), phage therapy (6), iron chelators, and gallium nitrate (7), have been developed to control infections with this bacterium. Of all the aforementioned strategies, vaccination might be the most effective approach to prevent infections associated with this bacterium, especially in target groups, such as the elderly, soldiers, and immunocompromised patients (8).
Multicomponent antigens and purified recombinant proteins are the two main vaccine strategies against A. baumannii. Although these immunogenic candidates showed acceptable results in animal models, they are not yet satisfactory for human injection (9, 10). Less attention has been paid to the extracellular proteins of A. baumannii as potential immunogenic candidates. According to the results from different bioinformatics databases and studies, this group of proteins plays an important role in the pathogenesis of A. baumannii (11).
With the advances in bioinformatics and the presence of the whole genome sequence of bacteria in various bioinformatics databases, such as Vaxign, the ideal promising immunogenic candidates can be found by reverse vaccinology method and in silico approach. In this context, it is worth mentioning that Meningococci group B represents the first example of the successful application of reverse vaccinology (12). With the consideration of all the above-mentioned information, this study investigated a dataset of A. baumannii whole-genomes to analyze extracellular or secreted proteins as putative immunogenic candidates.

2. Methods

2.1. Identification and Selection of Putative Immunogenic Candidates

In the first step, Vaxign (vaccine design webserver), a vaccine target prediction and analysis system based on the principle of reverse vaccinology, was used to select ideal putative immunogenic candidates. A total of 35 genome sequences of A. baumannii strains were selected from this database. Subsequently, the A. baumannii strain ACICU (belonging to ST2Pas) was determined as a reference strain. In the next step, the analysis was restricted to only extracellular proteins present in all genomes. In addition, other criteria, such as the number of transmembrane helices ≤ 1 and no similarity to human and mouse proteins, were considered (Figure 1) (13).
Flowchart for Identification of New Putative Immunogenic Candidates against <i>Acinetobacter baumannii</i> by Reverse Vaccinology Method (Containing All Databases, Tools, and Thresholds)
Figure 1.

Flowchart for Identification of New Putative Immunogenic Candidates against Acinetobacter baumannii by Reverse Vaccinology Method (Containing All Databases, Tools, and Thresholds)

2.2. Antigenicity Measurement and Function Prediction of Putative Immunogenic Candidates

The VaxiJen database is a helpful tool to predict protective antigens and subunit vaccines. This database was used to measure the antigenicity of putative immunogenic candidates with a cut-off ≥ 0.3 (14). The VICMpred is a useful database for the prediction of functional classes (e.g., virulence factors, cellular processes, and metabolism molecules). The amino acid sequence of each putative immunogenic candidate was submitted to this database to predict their functions and scores (15).

2.3. Identification of Major Histocompatibility Complex Class II Binding Sites

The prediction of CD4+ T cell immunogenicity was performed using the Immune Epitope Database (IEDB) Analysis Resource. In this study, the maximum combined score threshold was 50%, and a combined score ≥ 45 was acceptable. In the next step, the number of major histocompatibility complex class II (MHC-II) epitope binding sites was divided by the number of amino acids for each protein and expressed as ratios (16, 17).

2.4. Identification of Continuous and Discontinuous B-Cell Epitopes

BepiPred predicts the location of continuous B-cell epitopes from amino acid sequence using a Hidden Markov Model. For this purpose, the sequence of each protein in FASTA format with a threshold of ≥ 0.65 was submitted (18). In this part, similar to the MHC- II epitopes, the number of continuous B-cell epitopes was divided into the number of amino acids for each immunogenic candidate and reported as ratios.
ElliPro is another database for antibody epitope prediction. This database was used to predict the B-cell discontinuous epitopes of each putative immunogenic candidate with a threshold of ≥ 0.8 (19). The three-dimensional (3D) structure prediction files were obtained using Robetta servers and refined using the ModRefiner server. In the next step, their quality was checked using QMEAN Swiss Model. The Protein Data Bank (PDB) files of the putative immunogenic candidates were shown in the Jmol software (version 14) for illustration. This software is an open-source Java viewer for chemical structures in three dimensions (20). In the next step, the B-cell discontinuous epitopes of each immunogenic candidate were displayed on the surface of the proteins with different colors.

2.5. Evaluation of MHC-II and B-Cell Epitopes Conservancy among Different Strains of Acinetobacter baumannii

In this part, the MHC-II and B-cell epitopes were transmitted to Epitope Conservancy Analysis in IEDB Analysis Resource, and their conservation among different strains of A. baumannii was analyzed (21).

2.6. Identification of Conserved Domains in Selected Proteins

Conserved Domain Database is a part of NCBI’s Entrez query that provides an annotation of protein sequences with the location of the conserved domain. This database was used to predict the conserved domain of each putative immunogenic candidate (22).

2.7. Protein-Protein Interaction Network

The STRING is a helpful database for understanding how proteins interact with each other. This database contains information from numerous sources, including experimental data, computational prediction methods, and public texts. In this part, the STRING database was used to understand the interaction of uncharacterized proteins with other A. baumannii proteins. This approach can be effective for the function estimation of unknown proteins (23). The red spheres show the target proteins, and others represent other proteins in relation to the hypothetical proteins. Each interaction has a specific color (light blue: from curated databases, violet: experimentally determined, green: gene neighborhood, red: gene fusions, blue: gene co-occurrence, yellow: text mining, black: coexpression, grey: protein homology).

3. Results

3.1. Identification and Characterization of Putative Immunogenic Candidates

In this study, 19 extracellular proteins were discovered in the Vaxign database. The accession numbers and other characteristics of all 19 extracellular proteins are shown in Appendix 1 (see Supplementary File). All of these proteins have a ≤ 1 transmembrane helix. The proteins that have similarities to host proteins were excluded. The next step was to measure the antigenicity of the remaining proteins, and the proteins with the highest antigenicity value were considered potential immunogenic candidates. These proteins were FilF (ADX02311.1), FimA (ADX03638.1), putative acid phosphatase (ADX03936.1), putative exported protein (ADX04185.1), subtilisin-like serine protease (ADX04983.1), and three uncharacterized proteins (i.e., ADX02417.1, ADX04125.1, and ADX05009.1). According to VICMpred prediction, the aforementioned proteins are categorized as virulence factors, metabolic molecules, and cellular processes. Table 1 shows the complete results of this investigation.
Table 1.Characterization of Extracellular Proteins of Acinetobacter baumannii as Putative Immunogenic Candidates
No.Protein NameProtein DomainSubcellular Localization (PSORTb)MHC-II 15-mer Epitopes Sites (CS ≥ 45)T-Cell Epitope RatioB-cell Epitopes (T = 0.65)B-Cell Epitope RatioVaxiJen ScoreVICMpred
1FilFNo domainExtracellular200.03010 aa0.01540.64Virulence factors (2.18)
2Putative uncharacterized proteinNo domainExtracellular70.01418 aa0.0360.72Virulence factors (2.6)
3FimAFimbrial superfamily proteinExtracellular90.0266 aa0.0170.66Virulence factors (0.86)
4Putative acid phosphatasePolyphosphatase and 5'/3'-nucleotidase SurEExtracellular70.02120 aa0.0610.62Metabolism molecule (2.57)
5Putative uncharacterized proteinNo domainExtracellular140.0278 aa0.0150.54Virulence factors (0.32)
6Putative exported proteinTolA-binding proteinExtracellular80.02737 aa0.120.68Virulence factors (1.50)
7Uncharacterized proteinMlaD protein superfamilyExtracellular70.03030 aa0.130.73Cellular process (1.54)
8Subtilisin-like serine proteasePeptidase S8 familyExtracellular110.0253 aa0.0070.57Metabolism molecule (2.17)

Abbreviation: MHC-II, major histocompatibility complex class II.

3.2. Identification of MHC-II and Continuous and Discontinuous B-Cell Epitopes of Putative Immunogenic Candidates

Table 1 shows a list of the ratios of MHC-II and linear B-cell epitopes of each immunogenic candidate. In the case of discontinuous B-cell epitopes, the predicted epitopes were plotted on a 3D structure of the putative immunogenic candidates in Figure 2 (the full results of discontinuous B-cell epitopes prediction were listed in Appendix 2).
Predicted discontinuous B-cell epitopes of putative immunogenic candidates against <i>Acinetobacter baumannii</i> shown on a three-dimensional structure of proteins; FilF, uncharacterized protein (ADX02417.1), FimA, putative acid phosphatase, uncharacterized protein (ADX04125.1), putative exported protein, subtilisin-like serine protease, and uncharacterized proteins (ADX05009.1) with 10, 4, 2, 3, 7, 3, 3, and eight conformational epitopes, respectively.
Figure 2.

Predicted discontinuous B-cell epitopes of putative immunogenic candidates against Acinetobacter baumannii shown on a three-dimensional structure of proteins; FilF, uncharacterized protein (ADX02417.1), FimA, putative acid phosphatase, uncharacterized protein (ADX04125.1), putative exported protein, subtilisin-like serine protease, and uncharacterized proteins (ADX05009.1) with 10, 4, 2, 3, 7, 3, 3, and eight conformational epitopes, respectively.

3.3. Evaluation of MHC-II and B-Cell Epitopes Conservancy among Different Strains of Acinetobacter baumannii

Table 2 shows a summary of the results of MHC-II and B-cell epitopes conservancy among different strains of A. baumannii with the percentage of conservation. FimA, putative exported protein, and uncharacterized proteins, including ADX04125.1 and ADX05009.1, had high conserved epitopes.
Table 2.Conservancy Analysis of Top Score Major Histocompatibility Complex Class II and B-Cell Epitopes among Different Proteomes of Acinetobacter baumannii
Protein NameMHC-II EpitopesConservation (%)B-cell Linear EpitopesConservation (%)
FilFYLERNVFKTSGNVKT58.93CTPTTSDNGAEDS64.29
REIQSTTPLRLSFSN73.21TAVNGKSKEINP67.86
YLLTTKVKPAKLNVN69.64KGSAIVIDNKVQN67.86
DKNDETIKVAIALIK92.86TDIKPNSTTTDMS75.00
YKLLVQTTNLSNAGV69.64AATFNDPLNGDQS58.93
IVIDNKVQNPYLLTT67.86
FLGNVNLDTIGKFTA92.86
FimAMKKMLIKSGLLITSF90.00LNYPVSSIGNNV98.00
LITSFFIYNQTYANC100.00DSTDFSGYYPYKRSLTPNTTYTLS69.00
TTYTLSPGYFVMEVI97.00NGGENNSGVPTSNT97.00
SPGYFVMEVIKTAAT97.00ISDTSNSQVINN72.00
TTTVLSSSPILIASS97.00
VELLWNMNGANNPIR92.00
PLTARYYQTASNVTA94.00
Putative acid phosphataseALNILLVNDDGLTSN100.00NDKQIAAENGCHNGAAPIGAPAAGTFTKAGY86.00
GRGGAIVMYSSTTIT95.00NTVDDKTLNNPNS84.62
IVMYSSTTITADNDK95.00
PKNLTTSTPFAFSKI98.00
YKLKFQVTKDNKGNN73.00
GQEWLKIRLKSLFNK84.00
Putative exported proteinHSLLFIALMSTTSLY98.00PDSATQDDSSNATSDNTTPASAPAPQTTESNKVAAVPATQTSEQQPSAPTT37.00
IALMSTTSLYANIPI99.00AQNQSNSLEL71.00
TTSLYANIPIESRGL99.00
IAPMQNFIKNHPNSI93.00
NFIKNHPNSIYTGNA96.00
Subtilisin-like serine proteaseGIFVIIFGIALFFLA91.00TQATPAQQKTMEQQLISNMNSITSIDE30.00
LFFLAMKVSGLVGTN96.00GKVAAGSSSAEEKAPASTDSS41.00
GRVDSITLDPVTRLA97.00
MEQQLISNMNSITSI34.00
DEDAYIMVATNGLLG99.00
EKYLKIVPGGGLNYL50.00
Uncharacterized protein (ADX02417.1)MRQFTSLQVAILALG55TDSANLEKLRDNSSNI87.00
GQALMSMSYIAPTDS93.00DANGNPLPMSNEDRASS58.00
EAELEINTNIRKLQL87.00GTENTTTPNGIN61.00
VVGLRLSAEKFIGLL74.00NIYVGHSSSYPVDGTVQYNAAGPHDPAYPEPTGIYTQGGK78.00
ISGYMKVQSDSSGLI80.00
TANLNLTQSLGLIH97.00
NLTQSLGLIHNLPIN98.00
LGLIHNLPINSPMYL100.00
SPMYLALQNQMLQWP93.00
LFPQISAAVSAYLQA51.00
Uncharacterized protein (ADX04125.1)ASQDVYRSLLNAFKD91.00SSGGSSNTPKPSEPT100.00
YRSLLNAFKDTNIPS99.00ADLQDQSHLDPIG100.00
TLLDIAANQKVTRDY93.00GDYRRAVG100.00
GNTSEFFRIDGAGDY97.00NSSSSEPNNSTQQYN100.00
FFRIDGAGDYRRAVG99.00
CQLNFRANGQIELIK98.00
IELIKGSQSYRSALS92.00
QQYNFIQLHIKANKI94.00
IQLHIKANKIVSAQA94.00
Uncharacterized protein (ADX05009.1)LERRSYIATNKKNLQ99.00VVYSFDSAPDD100.00
AGGVQVLRDYNNLPL97.00VKYTSECSDS99.00
VLRDYNNLPLAFYRI99.00IGGVSWGNPVKCSDPTTAADKVACFSNG97.00
NDPNVKAVYPNRINR98.00
TKTKIIGIDVFRKVR96.00
IGIDVFRKVRSQGKW97.00
SSYGTAFANARAAGV98.00
IALLRANSVSPTESI97.00

Abbreviation: MHC-II, major histocompatibility complex class II.

3.4. Protein-Protein Interaction Network

According to the results from the STRING database, the uncharacterized protein with accession number ADX02417.1 had co-occurrence and neighborhood interactions with heme utilization protein. Another uncharacterized protein with accession number ADX04125.1 had neighborhood interactions with ClpA, ClpP, and ClpS. The CLP protease family is a family of serine peptidases. This class of enzymes cleaves peptide bonds in proteins, with serine serving as the nucleophilic amino acid at the (enzyme) active site (24). The last uncharacterized protein, ADX05009, belongs to the MlaD protein superfamily. This family of proteins contains MlaD, which is a component of the Mla pathway, an ATP-binding cassette transport system that maintains the asymmetry of the outer membrane (OM) (Figure 3) (25).
Protein-protein interaction network of uncharacterized proteins (ADX02417.1, ADX04125.1, and ADX05009.1) with other proteins of <i>Acinetobacter baumannii</i>; red spheres illustrating hypothetical proteins, and each of others representing other proteins in relation to hypothetical proteins.
Figure 3.

Protein-protein interaction network of uncharacterized proteins (ADX02417.1, ADX04125.1, and ADX05009.1) with other proteins of Acinetobacter baumannii; red spheres illustrating hypothetical proteins, and each of others representing other proteins in relation to hypothetical proteins.

4. Discussion

Acinetobacter baumannii is an emerging opportunistic pathogen responsible for healthcare-associated infections and has become a global problem (26). Due to the frequent outbreaks caused by multidrug-resistant A. baumannii, the development of a safe and effective vaccine appears necessary. Despite all efforts to date, there is still no licensed vaccine, and studies continue to find an ideal vaccine candidate (27). In terms of vaccinology, an ideal or promising immunogenic candidate should be exposed on the bacterial surface (OM or extracellular proteins) for host immune system induction, have a high antigenicity value, be conserved across circulating strains, and be expressed during bacterial infection. In addition, the ideal immunogenic candidates should have an important role in bacterial pathogenesis (28). In the case of A. baumannii, most studies focused on outer membrane proteins (OMPs), such as OmpA, OmpW, and Omp22 (29), and extracellular proteins were underestimated. However, studies showed that the consideration of OMPs as immunogenic candidates had some obstacles and limitations. For example, OmpA is the most abundant OMP in A. baumannii and is involved in host-cell recognition, biofilm formation, and antibiotic resistance. Nevertheless, the coexistence of different OmpA variants and subvariants in the A. baumannii population can severely limit the efficacy of a vaccine (30).
However, the present study focused on the extracellular proteins of A. baumannii and selected the best of them according to the defined criteria, such as transmembrane helix, antigenicity score, and high adhesion probability. The current study showed that extracellular proteins, such as FilF and FimA, can be considered putative immunogenic candidates. In line with the results of the present study, Singh et al. presented FilF protein as a putative vaccine candidate in an in vivo experiment. The aforementioned study showed that immunization with FilF can produce a high antibody titer and provide 50% protection against a standard lethal dose of A. baumannii (31). The expression of FimA, a type 1 fimbrial protein, increases during the bacterial infection process and leads to the association of bacteria to biofilm formation. In this context, the efficacy of FimA and FimH for vaccine development was previously investigated (32).
In line with the results of the current study, an in silico study conducted by Zadeh Hosseingholi et al. showed that proteins involved in pilus assembly and four hypothetical proteins were likely immunogenic candidates. The aforementioned results underscored the importance of the pilus assembly system in the pathogenesis and immunogenicity of A. baumannii. Furthermore, the aforementioned data suggest that in silico approaches might be helpful in discovering likely drug and immunogenic candidates that have been ignored up to now (33).
Moreover, putative acid phosphatase, putative exported protein, and subtilisin-like serine protease were determined as desirable immunogenic candidates. The acid phosphatase enzyme is able to dephosphorylate various organic substances (34). This enzyme plays a fundamental role in Gram-negative bacteria (35). The putative acid phosphatase has a SurE domain which is expressed when bacterial cells are under environmental stress and in the steady growth phase of bacteria (36). The putative exported protein has a TolA-binding domain which has a vital role in the import mechanisms for the uptake of bacteriocins and the deoxyribonucleic acid of filamentous bacteriophage (37). The subtilisin-like serine proteases are widespread enzymes among bacteria. For example, Mycosin-1, a subtilisin-like serine protease in Mycobacterium tuberculosis, is expressed after macrophages infection and is submitted to proteolytic processing (38).
This study identified three uncharacterized proteins as potential immunogenic candidates according to the defined criteria. The obtained results from the STRING database demonstrated that these proteins had a role in nutrition (heme utilization), peptide bond cleavage (serine peptidases), and cellular processes (MlaD protein), respectively. Another in silico approach by Mobarak Qamsari et al. indicated that the ZnuD protein is a potentially suitable antigen for subunit vaccine development. This protein belongs to TonB-dependent receptors and is involved in zinc acquisition (39). Among the aforementioned proteins, the uncharacterized protein with the MlaD protein superfamily domain is more desirable for further investigation due to its high score of MHC-II and B-cell epitopes ratios. MlaD stands for the maintenance of OM lipid asymmetry. In Gram-negative bacteria, the OM has an asymmetric structure, with lipopolysaccharides on the outer surface and phospholipids on the inner surface. This unique feature makes Gram-negative bacteria resistant to numerous toxic chemicals and antibiotics (40).
In the present study, in addition to the immunogenic candidates, several MHC-II and B-cell epitopes were identified. These epitopes were surface exposed and might robustly induce the host immune system. Several studies have been conducted on the antigenic epitopes of A. baumannii. Girija, for example, targeted the GacS protein involved in citrate utilization in A. baumannii and proposed five antigenic peptides as promiscuous vaccine candidates. It should be considered that these epitopes are valuable resources for multiepitope target design (41).

4.1. Conclusions

It appears that OMPs are suitable immunogenic candidates. However, due to some disadvantages of these proteins (e.g., antigenic variation), the consideration of extracellular proteins might compensate for the disadvantages and strengthen the vaccine formulation. Furthermore, this study proposed a list of potent immunogenic candidates of extracellular proteins. In addition to finding putative immunogenic candidates, this in silico approach provided new insights into the discovery of new virulence factors of A. baumannii that were previously undiscovered or ignored. However, discovering the effective immunogenic candidates or virulence factors requires further studies in animal models and role confirmation assays, such as site-directed mutagenesis.

4.2. Limitations

The results obtained from this study were only based on bioinformatics investigation; therefore, in vivo and in vitro investigations are needed to confirm the obtained results.

Acknowledgments

Footnotes

References

  • 1.
    Piran A, Shahcheraghi F, Solgi H, Rohani M, Badmasti F. A reliable combination method to identification and typing of epidemic and endemic clones among clinical isolates of Acinetobacter baumannii. Infect Genet Evol. 2017;54:501-7. [PubMed ID: 28827174]. https://doi.org/10.1016/j.meegid.2017.08.018.
  • 2.
    Nazari M, Azizi O, Solgi H, Fereshteh S, Shokouhi S, Badmasti F. Emergence of carbapenem resistant Acinetobacter baumannii clonal complexes CC2 and CC10 among fecal carriages in an educational hospital. Int J Environ Health Res. 2021:1-11. [PubMed ID: 33855919]. https://doi.org/10.1080/09603123.2021.1892036.
  • 3.
    Abhari SS, Badmasti F, Modiri L, Aslani MM, Asmar M. Circulation of imipenem-resistant Acinetobacter baumannii ST10, ST2 and ST3 in a university teaching hospital from Tehran, Iran. J Med Microbiol. 2019;68(6):860-5. [PubMed ID: 31050632]. https://doi.org/10.1099/jmm.0.000987.
  • 4.
    Garcia-Quintanilla M, Pulido MR, McConnell MJ. First steps towards a vaccine against Acinetobacter baumannii. Curr Pharm Biotechnol. 2013;14(10):897-902. [PubMed ID: 24372252]. https://doi.org/10.2174/1389201014666131226123511.
  • 5.
    Nielsen TB, Pantapalangkoor P, Luna BM, Bruhn KW, Yan J, Dekitani K, et al. Monoclonal Antibody Protects Against Acinetobacter baumannii Infection by Enhancing Bacterial Clearance and Evading Sepsis. J Infect Dis. 2017;216(4):489-501. [PubMed ID: 28931235]. [PubMed Central ID: PMC5853763]. https://doi.org/10.1093/infdis/jix315.
  • 6.
    LaVergne S, Hamilton T, Biswas B, Kumaraswamy M, Schooley RT, Wooten D. Phage Therapy for a Multidrug-Resistant Acinetobacter baumannii Craniectomy Site Infection. Open Forum Infect Dis. 2018;5(4):ofy064. [PubMed ID: 29687015]. [PubMed Central ID: PMC5905571]. https://doi.org/10.1093/ofid/ofy064.
  • 7.
    de Leseleuc L, Harris G, KuoLee R, Chen W. In vitro and in vivo biological activities of iron chelators and gallium nitrate against Acinetobacter baumannii. Antimicrob Agents Chemother. 2012;56(10):5397-400. [PubMed ID: 22825117]. [PubMed Central ID: PMC3457350]. https://doi.org/10.1128/AAC.00778-12.
  • 8.
    Fereshteh S, Abdoli S, Shahcheraghi F, Ajdary S, Nazari M, Badmasti F. New putative vaccine candidates against Acinetobacter baumannii using the reverse vaccinology method. Microb Pathog. 2020;143:104114. [PubMed ID: 32145321]. https://doi.org/10.1016/j.micpath.2020.104114.
  • 9.
    McConnell MJ, Dominguez-Herrera J, Smani Y, Lopez-Rojas R, Docobo-Perez F, Pachon J. Vaccination with outer membrane complexes elicits rapid protective immunity to multidrug-resistant Acinetobacter baumannii. Infect Immun. 2011;79(1):518-26. [PubMed ID: 20974823]. [PubMed Central ID: PMC3019872]. https://doi.org/10.1128/IAI.00741-10.
  • 10.
    Badmasti F, Ajdary S, Bouzari S, Fooladi AA, Shahcheraghi F, Siadat SD. Immunological evaluation of OMV(PagL)+Bap(1-487aa) and AbOmpA(8-346aa)+Bap(1-487aa) as vaccine candidates against Acinetobacter baumannii sepsis infection. Mol Immunol. 2015;67(2 Pt B):552-8. [PubMed ID: 26277277]. https://doi.org/10.1016/j.molimm.2015.07.031.
  • 11.
    Li H, Tan H, Hu Y, Pan P, Su X, Hu C. Small protein A and phospholipase D immunization serves a protective role in a mouse pneumonia model of Acinetobacter baumannii infection. Mol Med Rep. 2017;16(2):1071-8. [PubMed ID: 28586022]. [PubMed Central ID: PMC5561983]. https://doi.org/10.3892/mmr.2017.6688.
  • 12.
    Ladhani SN, Campbell H, Parikh SR, Saliba V, Borrow R, Ramsay M. The introduction of the meningococcal B (MenB) vaccine (Bexsero(R)) into the national infant immunisation programme--New challenges for public health. J Infect. 2015;71(6):611-4. [PubMed ID: 26433141]. https://doi.org/10.1016/j.jinf.2015.09.035.
  • 13.
    He Y, Xiang Z, Mobley HL. Vaxign: the first web-based vaccine design program for reverse vaccinology and applications for vaccine development. J Biomed Biotechnol. 2010;2010:297505. [PubMed ID: 20671958]. [PubMed Central ID: PMC2910479]. https://doi.org/10.1155/2010/297505.
  • 14.
    Zaharieva N, Dimitrov I, Flower DR, Doytchinova I. VaxiJen Dataset of Bacterial Immunogens: An Update. Curr Comput Aided Drug Des. 2019;15(5):398-400. [PubMed ID: 30887928]. https://doi.org/10.2174/1573409915666190318121838.
  • 15.
    Saha S, Raghava GPS. VICMpred: An SVM-based Method for the Prediction of Functional Proteins of Gram-negative Bacteria Using Amino Acid Patterns and Composition. Genomics, Proteomics & Bioinformatics. 2006;4(1):42-7. https://doi.org/10.1016/s1672-0229(06)60015-6.
  • 16.
    Fereshteh S, Sepehr A, Rahimirad N, Sanikhani R, Badmasti F. In silico evaluation of surface-exposed proteins of severe acute respiratory syndrome coronavirus 2 to propose a multi-epitope vaccine candidate. Heath biotechnol biopharma. 2021;4(4):51-72.
  • 17.
    Wang P, Sidney J, Kim Y, Sette A, Lund O, Nielsen M, et al. Peptide binding predictions for HLA DR, DP and DQ molecules. BMC Bioinformatics. 2010;11:568. [PubMed ID: 21092157]. [PubMed Central ID: PMC2998531]. https://doi.org/10.1186/1471-2105-11-568.
  • 18.
    Jespersen MC, Peters B, Nielsen M, Marcatili P. BepiPred-2.0: improving sequence-based B-cell epitope prediction using conformational epitopes. Nucleic Acids Res. 2017;45(W1):W24-9. [PubMed ID: 28472356]. [PubMed Central ID: PMC5570230]. https://doi.org/10.1093/nar/gkx346.
  • 19.
    Ponomarenko J, Bui HH, Li W, Fusseder N, Bourne PE, Sette A, et al. ElliPro: a new structure-based tool for the prediction of antibody epitopes. BMC Bioinformatics. 2008;9:514. [PubMed ID: 19055730]. [PubMed Central ID: PMC2607291]. https://doi.org/10.1186/1471-2105-9-514.
  • 20.
    Glasser L, Herráez A, Hanson RM. Interactive 3D Phase Diagrams Using Jmol. J Chem Educ. 2009;86(5). https://doi.org/10.1021/ed086p566.
  • 21.
    Bui HH, Sidney J, Li W, Fusseder N, Sette A. Development of an epitope conservancy analysis tool to facilitate the design of epitope-based diagnostics and vaccines. BMC Bioinformatics. 2007;8:361. [PubMed ID: 17897458]. [PubMed Central ID: PMC2233646]. https://doi.org/10.1186/1471-2105-8-361.
  • 22.
    Lu S, Wang J, Chitsaz F, Derbyshire MK, Geer RC, Gonzales NR, et al. CDD/SPARCLE: the conserved domain database in 2020. Nucleic Acids Res. 2020;48(D1):D265-8. [PubMed ID: 31777944]. [PubMed Central ID: PMC6943070]. https://doi.org/10.1093/nar/gkz991.
  • 23.
    Szklarczyk D, Franceschini A, Wyder S, Forslund K, Heller D, Huerta-Cepas J, et al. STRING v10: protein-protein interaction networks, integrated over the tree of life. Nucleic Acids Res. 2015;43(Database issue):D447-52. [PubMed ID: 25352553]. [PubMed Central ID: PMC4383874]. https://doi.org/10.1093/nar/gku1003.
  • 24.
    Maurizi MR, Clark WP, Katayama Y, Rudikoff S, Pumphrey J, Bowers B, et al. Sequence and structure of Clp P, the proteolytic component of the ATP-dependent Clp protease of Escherichia coli. J Biol Chem. 1990;265(21):12536-45. https://doi.org/10.1016/s0021-9258(19)38378-4.
  • 25.
    Isom GL, Davies NJ, Chong ZS, Bryant JA, Jamshad M, Sharif M, et al. MCE domain proteins: conserved inner membrane lipid-binding proteins required for outer membrane homeostasis. Sci Rep. 2017;7(1):8608. [PubMed ID: 28819315]. [PubMed Central ID: PMC5561183]. https://doi.org/10.1038/s41598-017-09111-6.
  • 26.
    Morris FC, Dexter C, Kostoulias X, Uddin MI, Peleg AY. The Mechanisms of Disease Caused by Acinetobacter baumannii. Front Microbiol. 2019;10:1601. [PubMed ID: 31379771]. [PubMed Central ID: PMC6650576]. https://doi.org/10.3389/fmicb.2019.01601.
  • 27.
    Bolourchi N, Shahcheraghi F, Shirazi AS, Janani A, Bahrami F, Badmasti F. Immunogenic reactivity of recombinant PKF and AbOmpA proteins as serum resistance factors against sepsis of Acinetobacter baumannii. Microb Pathog. 2019;131:9-14. [PubMed ID: 30930220]. https://doi.org/10.1016/j.micpath.2019.03.031.
  • 28.
    D'Mello A, Ahearn CP, Murphy TF, Tettelin H. ReVac: a reverse vaccinology computational pipeline for prioritization of prokaryotic protein vaccine candidates. BMC Genomics. 2019;20(1):981. [PubMed ID: 31842745]. [PubMed Central ID: PMC6916091]. https://doi.org/10.1186/s12864-019-6195-y.
  • 29.
    Badmasti F, Habibi M, Firoozeh F, Fereshteh S, Bolourchi N, Goodarzi NN. The combination of CipA and PBP-7/8 proteins contribute to the survival of C57BL/6 mice from sepsis of Acinetobacter baumannii. Microb Pathog. 2021;158:105063. [PubMed ID: 34166729]. https://doi.org/10.1016/j.micpath.2021.105063.
  • 30.
    Viale AM, Evans BA. Microevolution in the major outer membrane protein OmpA of Acinetobacter baumannii. Microb Genom. 2020;6(6). https://doi.org/10.1099/mgen.0.000381.
  • 31.
    Singh R, Garg N, Shukla G, Capalash N, Sharma P. Immunoprotective Efficacy of Acinetobacter baumannii Outer Membrane Protein, FilF, Predicted In silico as a Potential Vaccine Candidate. Front Microbiol. 2016;7. https://doi.org/10.3389/fmicb.2016.00158.
  • 32.
    Hajialibeigi A, Amani J, Gargari SLM. Identification and evaluation of novel vaccine candidates against Shigella flexneri through reverse vaccinology approach. Appl Microbiol Biotechnol. 2021;105(3):1159-73. [PubMed ID: 33452891]. [PubMed Central ID: PMC7811352]. https://doi.org/10.1007/s00253-020-11054-4.
  • 33.
    Zadeh Hosseingholi E, Zarrini G, Pashazadeh M, Gheibi Hayat SM, Molavi G. In Silico Identification of Probable Drug and Vaccine Candidates Against Antibiotic-Resistant Acinetobacter baumannii. Microb Drug Resist. 2020;26(5):456-67. [PubMed ID: 31742478]. https://doi.org/10.1089/mdr.2019.0236.
  • 34.
    Neal AL, Blackwell M, Akkari E, Guyomar C, Clark I, Hirsch PR. Phylogenetic distribution, biogeography and the effects of land management upon bacterial non-specific Acid phosphatase Gene diversity and abundance. Plant Soil. 2018;427(1):175-89. [PubMed ID: 30996484]. [PubMed Central ID: PMC6438641]. https://doi.org/10.1007/s11104-017-3301-2.
  • 35.
    Amoozadeh M, Behbahani M, Mohabatkar H, Keyhanfar M. Analysis and comparison of alkaline and acid phosphatases of Gram-negative bacteria by bioinformatic and colorimetric methods. J Biotechnol. 2020;308:56-62. [PubMed ID: 31705933]. https://doi.org/10.1016/j.jbiotec.2019.11.002.
  • 36.
    Li C, Wu PY, Hsieh M. Growth-phase-dependent transcriptional regulation of the pcm and surE genes required for stationary-phase survival of Escherichia coli. Microbiology (Reading). 1997;143 ( Pt 11):3513-20. [PubMed ID: 9387229]. https://doi.org/10.1099/00221287-143-11-3513.
  • 37.
    Deprez C, Lloubes R, Gavioli M, Marion D, Guerlesquin F, Blanchard L. Solution structure of the E.coli TolA C-terminal domain reveals conformational changes upon binding to the phage g3p N-terminal domain. J Mol Biol. 2005;346(4):1047-57. [PubMed ID: 15701516]. https://doi.org/10.1016/j.jmb.2004.12.028.
  • 38.
    Dave JA, Gey van Pittius NC, Beyers AD, Ehlers MR, Brown GD. Mycosin-1, a subtilisin-like serine protease of Mycobacterium tuberculosis, is cell wall-associated and expressed during infection of macrophages. BMC Microbiol. 2002;2:30. [PubMed ID: 12366866]. [PubMed Central ID: PMC131053]. https://doi.org/10.1186/1471-2180-2-30.
  • 39.
    Mobarak Qamsari M, Rasooli I, Darvish Alipour Astaneh S. Identification and immunogenic properties of recombinant ZnuD protein loops of Acinetobacter baumannii. Inform Med Unlocked. 2020;19:100342. https://doi.org/10.1016/j.imu.2020.100342.
  • 40.
    Liu C, Ma J, Wang J, Wang H, Zhang L. Cryo-EM Structure of a Bacterial Lipid Transporter YebT. J Mol Biol. 2020;432(4):1008-19. [PubMed ID: 31870848]. https://doi.org/10.1016/j.jmb.2019.12.008.
  • 41.
    Smiline Girija AS. Delineating the Immuno-Dominant Antigenic Vaccine Peptides Against gacS-Sensor Kinase in Acinetobacter baumannii: An in silico Investigational Approach. Front Microbiol. 2020;11:2078. [PubMed ID: 33013757]. [PubMed Central ID: PMC7506167]. https://doi.org/10.3389/fmicb.2020.02078.

Crossmark
Crossmark
Checking
Share on
Cited by
Metrics

Purchasing Reprints

  • Copyright Clearance Center (CCC) handles bulk orders for article reprints for Brieflands. To place an order for reprints, please click here (   https://www.copyright.com/landing/reprintsinquiryform/ ). Clicking this link will bring you to a CCC request form where you can provide the details of your order. Once complete, please click the ‘Submit Request’ button and CCC’s Reprints Services team will generate a quote for your review.
Search Relations

Author(s):

Related Articles