Production of IFN-γ and IL-4 Against Intact Catalase and Constructed Catalase Epitopes of Helicobacter pylori From T-Cells

Author(s):
Hajieh Ghasemian SafaeiHajieh Ghasemian Safaei1, Jamshid FaghriJamshid Faghri1, Sharareh MoghimSharareh Moghim1, Bahram Nasr EsfahaniBahram Nasr Esfahani1, Hossein FazeliHossein Fazeli1, Manoochehr MakvandiManoochehr Makvandi2, Minoo AdibMinoo Adib3, Niloufar RashidiNiloufar Rashidi4, 5,*
1Department of Microbiology, Faculty of Medicine, Isfahan University of Medical Sciences, Isfahan, IR Iran
2Department of Virology, Faculty of Medicine, Ahvaz Jundishapur University of Medical Sciences, Ahvaz, IR Iran
3Department of Immunology, Faculty of Medicine, Isfahan University of Medical Sciences, Isfahan, IR Iran
4Department of Laboratory Sciences, Paramedical School, Ahvaz Jundishapur University of Medical Sciences, Ahvaz, IR Iran
5Research Institute for Infectious Disease of Digestive System, Ahvaz Jundishapur University of Medical Sciences, Ahvaz, IR Iran

Jundishapur Journal of Microbiology:Vol. 8, issue 12; e59921
Published online:Dec 13, 2015
Article type:Research Article
Received:Nov 12, 2014
Accepted:Oct 04, 2015
How to Cite:Ghasemian Safaei H, Faghri J, Moghim S, Nasr Esfahani B, Fazeli H, et al. Production of IFN-γ and IL-4 Against Intact Catalase and Constructed Catalase Epitopes of Helicobacter pylori From T-Cells. Jundishapur J Microbiol. 2015;8(12):e59921. doi: https://doi.org/10.5812/jjm.24697

Abstract

Background:

Helicobacter pylori infection is highly prevalent in the developing countries. It causes gastritis, peptic ulcer disease, and gastrocarcinoma. Treatment with drugs and antibiotics is problematic due to the following reasons: cost, resistance to antibiotics, prolonged treatment and using multiple drugs. Catalase is highly conserved among the Helicobacter species and is important to the survival of the organism. It is expressed in high amounts and is exposed to the surface of this bacterium; therefore it represents a suitable candidate vaccine antigen.

Objectives:

A suitable approach in H. pylori vaccinology is the administration of epitope based vaccines. Therefore the responses of T-cells (IFN-γ and IL-4 production) against the catalase of H. pylori were determined. Then the quality of the immune responses against intact catalase and three epitopes of catalase were compared.

Materials and Methods:

In this study, a composition of three epitopes of the H. pylori catalase was selected based on Propred software. The effect of catalase epitopes on T-cells were assayed and immune responses identified.

Results:

The results of IFN-γ, IL-4 production against antigens, epitopes, and recombinant catalase by T-cells were compared for better understanding of epitope efficiency.

Conclusions:

The current research demonstrated that epitope sequence stimulates cellular immune responses effectively. In addition, increased safety and potency as well as a reduction in time and cost were advantages of this method. Authors are going to use this sequence as a suitable vaccine candidate for further research on animal models and humans in future.

1. Background

Helicobacter pylori mainly cause peptic ulcers, gastritis, gastric adenocarcinoma, and malignant mucosa-associated lymphoid tissue (MALT) lymphomas. This bacterium infects a huge population worldwide (50%) and prevails mostly in the developing countries (1-4). A combination of two or three antibiotics and a proton pump inhibitor is suitable to treat H. pylori, but this combination has some disadvantages including antibiotic resistance, long-term complications of antibiotic treatments, poor patient compliance, re-infection, high costs, and side effects (2, 3, 5, 6).
Vaccination strategies are reliable and effective to prevent H. pylori colonization (7, 8). The epitope-based vaccination is a relatively new strategy designed to fight pathogens including HIV, malaria, tuberculosis and H. pylori. Usually, bioinformatics tools introduce the amino acid sequences (8 - 10 amino acids) of proteins as epitopes. In this method, selected epitope sequences of the pathogen binding to the major histocompatibility complex (MHC) to stimulate T-cell responses are assayed. Therefore, it is important to choose epitopes derived from conserved peptide sequences. This can be facilitated by bioinformatics approaches that enhance the selection of potential epitopes that can be tested experimentally (9-11). Epitope-based vaccination is advantageous because of these factors: lack of infectious substance, no cold chain required during transport, large-scale production, stability, and lack of carcinogenesis potency (12). Catalase is considered a suitable antigen for immunization. It is highly expressed on bacterial surfaces and is important for H. pylori since it facilitates survival of the bacterium in microaerophilic environments, and the conserved sequence of H. pylori catalase (98% - 100% similarity is observed in enzymatic sequences of all strains) makes it significant for vaccination research (11, 13, 14).

2. Objectives

The current study aimed to investigate the T-cell production of IFN-γ and IL-4 against the designed epitopes of the catalase protein. The responses of T-cells (IFN-γ and IL-4 production) against the catalase of H. pylori were determined. Then the quality of the immune responses against intact catalase and three epitopes of catalase were compared.

3. Materials and Methods

Specific sequences of the catalase and prediction of T-cell epitopes from these sequences were identified according to the published data (11). The selected epitope MVNKDVKQTTKKVLLQSTWFLKKFHPFDVTKI was synthesized (Canpeptid, Canada). Purity of the peptide was 95.3% and the quantity was 10 mg. Solubility of the synthesized epitope was 1 mg in 1 mL H2O (concentration: 1 mg/mL).

3.1. Amplification of the Catalase Gene

PCR was performed using the following compounds: 3µL 10× buffer, 0.3 µL Taq polymerase (5 u/µL), 1µL forward primer (10 ρm), 1 µL reverse primer (10 ρm), 0.6 µL dNTP (10 mM) ,0.9 µL MgCl2 (50 mM), 4.6 µL template (0.65 µg/µL), and H2O to 30 µL. Conditions (35 cycles): initial denaturation at 94˚C for 10 minutes, denaturation at 94˚C for 1 minute, annealing at 55˚C for 40 seconds, extension at 72˚C for 90 seconds and final extension at 72˚C for 5 minutes .After amplification, the PCR product was purified using a PCR purification kit (Qiagen, Germany). Then primers were designed (Allel ID software) and synthesized (TAG Copenhagen Denmark).
Fw: 5'-AAAAAGGAATTCCATATGGTTAATAAAGATGTGAAACAAA-3'
R: 5'-AAAAAACGCGGATCCTTAAACTCCCTCAGCGTATTTG-3'
The length of the amplified DNA fragment encoding H. pylori catalase was 1437 base pair.

3.2. Vector Selection and Catalase Gene Cloning

The pET15b vector (Novagen, USA) was selected. PCR product and pET15b vector were digested using restriction endonucleases BamHI and NdeI (Fermentas, Germany) and ligated with T4 DNA ligase (Fermentas, Germany). The recombinant plasmid was transformed to Escherichia coli BL21 (DE3). The positive clones were screened by PCR, double digestion, and sequencing (2, 3).

3.3. Recombinant Helicobacter pylori Catalase

Cultures of transformed BL21 (DE3) were carried out overnight in 10 mL LB broth by ampicillin (100 µg/mL) at 37˚C. On the following day, the bacteria cultures were diluted in LB broth and grown until OD 600 nm = 0.6; then IPTG was added to a final concentration of 1 mM. After 4 hours, the cells were harvested by centrifugation. The pellet was lysed, and catalase was purified from bacterial lysate by Ni-NTA spin kit (Qiagen, Germany). The concentration of the purified protein was 2.42 mg/mL (DNA Star software). The purified products were analyzed by 12% SDS-PAGE (2, 3, 6, 14, 15).

3.4. Confirmation of Recombinant Helicobacter pylori Catalase

Further confirmation of the identity of purified catalase was obtained by western blotting with a mouse monoclonal [HIS.H8] to 6 His tag (Abcam, Canada) (2, 6, 14, 15). LPS content was assayed by a limulus amebocyte lysate (LAL) kit (Lonza), which was about 0.5 endotoxin units Eu/mL of solution. Finally the endotoxin was removed with an endotoxin removing kit (Norogen, Biotek) and the residual LPS content was under 0.1 Eu/mL (3).

3.5. Identification of the Infected and Healthy Individuals

Patients infected with H. pylori (n = 11) and individuals without an H. pylori infection (n = 11) were identified according to the protocol of an enzyme immunoassay kit (H. pylori Antigen, cat. no. 6010, Generic assay, Dahlewitz, Germany) to determine the H. pylori antigen in fecal specimens. Anti-H. pylori IgG and IgM in the serum of these individuals were assayed by an ELISA kit (Anti-H. pylori IgG and IgM, Monobind, CA, USA) (16).

3.6. Lymphocyte Proliferation Assays

Peripheral blood mononuclear cells (PBMC) were separated from the blood samples of 22 subjects by centrifugation on a Ficoll-Hypaque gradient (2500 rpm for 20 minutes) (Sigma, USA). Then, PBMC were collected, washed twice, pelleted, and resuspended in an RPMI 1640 medium (Sigma, USA) supplemented with 100 μg/mL penicillin/streptomycin (Gibco, UK) and 10% heat-inactivated fetal bovine serum (FBS) (Gibco, UK). PBMC (1×105) were cultured in 96-well round-bottomed plates. The catalase enzyme and epitopes at a final concentration of 10 μg/mL (2, 3, 5, 17) were added to each well. Total volume of each well was 200 μL; therefore each antigen was used in 2 μg wells. A negative control consisted of PBMC in the medium alone and positive controls were considered as cells plated in 5 μg/mL PHA. Tests were carried out in duplicate. The plates were incubated at 37°C in a 5% CO2 humidified incubator for two days. Then the amount of lymphocyte proliferation in response to antigens was assayed by a cell proliferation ELISA BrdU kit (Roche, Germany), according to the protocol. Before the cell proliferation test (after centrifuge), aliquots of 120 µL of the cell free supernatants were removed and stored at -20ºC and later tested for cytokines IFN-γ and IL-4 by ELISA (1, 15).

3.7. Cytokine Production Assays

IFN-γ and IL-4 responses were calculated in ρg/mL from the mean of duplicate ELISA wells. Lymphocyte culture supernatants (120 µL each) were collected after 48 hours and tested by ELISA. Cytokines were quantified by IFN-γ and IL-4 specific ELISA kits (Abcam, Canada). All assays were performed according to the manufacturers’ protocol (1-3).

3.8. IFN-γ Specific ELISpot Assay

The frequency of catalase and epitope-specific T-lymphocytes was determined by an IFN-γ specific ELISpot assay. ELISpot assays were performed in 96-well micro titer plates coated with anti-human IFN-γ (Abcam, Canada). Separated PBMC (1 × 105/well) were transferred to ELISpot plates. Epitopes and catalase enzymes were added to the wells at a final concentration of 10 μg/mL and incubated for 24 hours according to manufacturer’s protocol. Negative and positive controls comprised of cells with no antigens and cells with 1 ηg/mL PMA and 500 ηg/mL ionomycine, respectively. ELISpot plates were developed with biotin anti-IFN-γ, streptavidin alkaline phosphatase, and BCIP/NBT, (Abcam, Canada). The responses were considered positive when a number of spots, at least twice the negative controls (stimulation index ≥ 2), were observed and also there were contained greater than 20 spots per one million cells over the negative control (one response over negative control per 50,000 PBMC). Tests were carried out in duplicate (17).

3.9. Statistical Analysis

Data were expressed as the mean ± standard deviation (SD) and processed by Wilcoxon signed-rank and Mann-Whitney tests. A value of P < 0.05 was considered statistically significant.

4. Results

4.1. Amplification of Catalase Gene by PCR

The catalase gene was amplified by PCR using the designed primers. The detectable band showed the catalase gene (1437 bp).

4.2. Confirmation of the Catalase Gene in pET15b

After cloning, the existence of catalase gene in pET15b was confirmed by: 1- PCR and detection of band 1437 bp (Figure 1A); 2- Double digestion with BamHI and NdeI to detect two bands of catalase gene and pET15b plasmid (1437 bp and 5708 bp) (Figure 1B) and 3-Sequencing (Bionear Korean Company).
A, confirmation of the catalase band by PCR after cloning; B, catalase and pET-15b bands after double digestion; columns A and B, double digestion products; column C, PCR product control; column D, plasmid control; column M, Marker.
Figure 1.

A, confirmation of the catalase band by PCR after cloning; B, catalase and pET-15b bands after double digestion; columns A and B, double digestion products; column C, PCR product control; column D, plasmid control; column M, Marker.

4.3. Purification of the Recombinant Catalase

After expression and purification, the purified recombinant catalase was assayed by SDS-PAGE (Figure 2A). The catalase band (53 KDa) was detected. Finally, confirmation of the recombinant catalase was performed by western blot (anti-his-tag) and detection of catalase band (53 KDa) (Figure 2B).
A, Single band of catalase enzyme (SDS-PAGE) after purification columns; A and C, pure protein; column B, lysate before purification; column M, Marker; B, confirmation of catalase enzyme expression by western blot.
Figure 2.

A, Single band of catalase enzyme (SDS-PAGE) after purification columns; A and C, pure protein; column B, lysate before purification; column M, Marker; B, confirmation of catalase enzyme expression by western blot.

4.4. Selection of the Infected and Healthy Individuals

Eleven healthy and eleven infected patients were identified based on the presence of H. Pylori antigen in their feces and IgG and IgM in their serums.

4.5. T-Cell Proliferation Responses to Recombinant Catalase and Predicted Epitopes

PBMCs isolated from blood specimens were induced by recombinant catalase and epitopes. To identify the catalase and peptide antigens, they were recognized by CD4+ T-cell. T-cell proliferation responses to recombinant catalase and epitopes were assayed by the cell proliferation kit as described. Responses of T-cell to peptide and catalase are shown in Table 1. Results of the cell proliferation test were reported according to the ratio of optical density (OD) parameter response of stimulated cells by epitopes or catalase to OD of negative controls for infected or healthy individuals. Totally, 13 out of 22 individuals (four infected and nine healthy) responded to the recombinant catalase (59%) and 13 out of 22 individuals (four infected and nine healthy) responded to peptide (59%). Results are reported as the mean ± standard deviation (SD). Also results are based absorbance (OD): Mean ± SD for responses of four infected individuals to the peptide was 2.28 ± 1.4. Mean ± SD for responses of four infected individuals to recombinant catalase was 1.84 ± 0.52. Mean ± SD for responses of nine healthy individuals to peptide was1.67 ± 0.85 and Mean ± SD for responses of nine healthy individuals to recombinant catalase was 2.32 ± 2.7.The differences between the means of T-cell proliferation against peptide and recombinant catalase in the infected and healthy groups were not significant (P > 0.05).
Table 1. T-cell Proliferation Responses to Epitopes and Recombinant Catalase in the Infected and Healthy Individuals
NaMissingbAbsorbancecMin - Max
Epitopes
Group 1d472.28 ± 1.40.712 - 1.944
Group 2e921.67 ± 0.850.52 - 2
Catalase
Group 1d471.84 ± 0.520.417 - 1. 35
Group 2e922.32 ± 2.70.477 - 1.2

aNumber of the individuals who responded.

bNumber of the individuals who didn’t respond.

cValues are presented as mean ± SD.

dInfected individuals.

eHealthy individuals.

4.6. Cytokine Products Induced by Epitopes

As shown in Table 2, after the stimulation of PBMCs in epitopes and catalase, the levels of cytokines IFN-γ and IL-4 in response to epitopes and catalase were detected by an ELISA test. Results are reported as the mean ± standard deviation (SD).
Table 2. Results of Cytokine Production Against Epitopes and Catalase in the Infected and Healthy Individuals
VariablesNaMissingbAmount of CytokinecMin - Max
Epitopes
IL.4 production ρg/mL
Group 11100.193 ±.430.000 - 1.178
Group 21100.889 ± 2.60.000 - 8.800
IFN.γ production ρg/mL
Group 111019.89 ± 16.120.000 - 47.100
Group 211028.40 ± 17.990.055 - 61.300
Recombinant Catalase
IL.4 production ρg/mL
Group 1d1101.47 ±.9370.000 - 3.25
Group 2e1101.45 ± 1.190.000 - 3.4 00
IFN.γ production ρg/mL
Group 1d11020.8 ± 15.30.846 - 40
Group 2e11025.28 ± 15.70.000 - 46

aNumber of the individuals who responded.

bNumber of the individuals who didn’t respond.

cValues are presented as mean ± SD.

dInfected individuals.

eHealthy individuals.

4.7. Determination of the Epitope-Specific T-Lymphocytes With IFN-γ Specific ELISpot Assay

Of the 22 individuals, 11 (five infected and six healthy) responded positively to the catalase measured by ELISpot (50%) and 12 (four infected and eight healthy) responded positively to the epitopes measured by ELISpot (54%) (Table 3). The differences between the mean of both groups (infected and healthy) were not significant as determined by the Mann-Whitney test (Table 4). According to the Wilcoxon signed-rank test, the differences between the means of cell proliferation, ELISpot, IL-4 and IFN-γ production against epitopes and recombinant catalase in the healthy group were not significant (P > 0.05) (Table 5). The differences between the means of cell proliferation, ELISpot, IL-4, and IFN-γ production against epitopes and recombinant catalase in the infected group were not significant (P > 0.05) (Table 6). The differences between the means of IL-4 production against catalase epitopes and recombinant catalase in the infected group, however, are significant (P < 0.05) (Table 6).
Table 3.Results of IFN-γ Specific ELISpot Assay in the Infected and Healthy Individuals
NaMissingbNumber of SpotscMin - Max
Epitopes
Group 1d47103.7 ± 131.815 - 300
Group 2e83143.6 ± 136.67 - 300
Catalase
Group 1d5679.4 ± 12510 - 300
Group 2e65120.3 ± 139.87 - 300

aNumber of the individuals who responded.

bNumber of the individuals who didn’t respond.

cValues are presented as mean ± SD.

dInfected individuals.

eHealthy individuals.

Table 4. Comparison of Cytokine Production and Cell Proliferation Between the Infected and Healthy Groups
VariablesEpitopeCatalase
ZP ValuesZP Values
IL.4-0.0980.922-0.2310.817
IFN.γ-1.1490.250-0.4600.646
ELISpot-0.870.931-0.5530.580
Cell proliferation-1.3460.193-1.5430.133
Table 5. Comparison of Cytokine Production, ELISpot and Cell Proliferation Against Epitope and Recombinant Catalase Among Healthy Individuals
Cat–EpitopeZP Values
IL-4-1.480.139
IFN-γ-0.1780.859
ELISpot-1.340.180
Cell proliferation-0.2670.790
Table 6. Comparison of Cytokine Production, ELISpot and Cell Proliferation Against Epitope and Recombinant Catalase Among the Infected Individuals
Cat–EpitopeZP Values
IL-4-2.590.009
IFN-γ-0.4450.657
ELISpot-10.317
Cell proliferation-0.7110.477

5. Discussion

Helicobacter pylori are invasive bacteria (18, 19) that cause gastritis, peptic ulcer, and gastric cancer. Around 50% of the people worldwide are infected by H. pylori. Prevalence in the developing countries range from 20% to more than 80%. Less than 20% of the infected individuals will develop a gastroduodenal disease. In 1994, World Health Organization (WHO) classified H. pylori as a grade I carcinogen (1, 4, 6, 11, 16, 20-23). Helicobacter pylori is successfully eradicated by antibiotics together with a proton pump inhibitor, however, there are potential problems (1-3, 5, 13).
Chronic gastritis has no symptoms in many cases and may lead to cancer (3). Therefore, the prevention and treatment of H. pylori infection should be considered in the healthcare policy, especially in the developing countries where infection is highly prevalent (6, 24, 25). Furthermore, studies regarding the transmission of H. pylori infection within the family have supported the necessity of prevention and treatment, especially in children (23, 26). Vaccination is considered the most economic and efficient method for prevention and treatment, particularly in the developing countries (27, 28). Protective immune responses based on epitopes can play an important role in prevention and treatment. Epitopes that mediate APC are recognized by CD4+ T-cells and can be used as suitable vaccination tools for (11).
Currently, catalase is a suitable vaccine candidate (5, 6, 13, 14, 29). It is a highly conserved enzyme sequence with a similarity of approximately 98%-100% in different H. pylori isolates (11). Expression of catalase is high, and this enzyme is an important virulence factor of H. pylori (11, 14). Therefore, catalase can be a good vaccine candidate against H. pylori. The results of recombinant catalase and epitopes effects (479 amino acids) on PBMC cultures from 22 individuals were assayed. It is necessary to explain that the size of the H. pylori catalase gene is 1515 bp and the size of the catalase enzyme is 505 amino acids. Designed primers, however, covered 1437 bp, because the quality of the reverse primer was important to the study and in 3' end of the catalase gene there were high amounts of T and A bases.
Propred software showed that a loss of almost 200 end nucleotide from the catalase gene was not effective in immune responses, because in this sequence there were no epitopes (11). Enzyme activity did not consider in this study, but immune responses were significant. Therefore, even if the elimination of the end nucleotides was effective on activity, it was not sufficient for the study. Thus, 1437 bp were considered from the gene for amplification. To check the difference between the responses of infected and healthy individuals (prophylactic and protective effects), responses in both groups were assayed. According to the Mann-Whitney test, the differences between the cell proliferation means of the two groups (infected and healthy) were not significant (P > 0.05). The result of the ELISpot test also showed that the differences between the means of both groups were not significant, as determined by the Mann-Whitney test (P > 0.05).
According to the IFN-γ and IL-4 ELISA assay, the differences between the means of production of IFN-γ and IL-4 by T-cells in both groups (infected and healthy) were not significant (P > 0.05), as determined by Mann-Whitney test. On the other hand, it was noticed that the IFN-γ production mean in the subjects was more than that of IL-4. The current investigation did not observe significant differences between the production of IFN-γ and IL-4 in the healthy and infected groups. According to the Wilcoxon signed-rank test, differences between the means of cell proliferation, ELISpot, IL-4, and IFN-γ production against catalase epitopes and recombinant catalase in the healthy group were not significant (P > 0.05) (Table 5). Additionally, the differences between the means of cell proliferation, ELISpot, IL-4, and IFN-γ production against catalase epitopes and recombinant catalase in the infected group were not significant (P > 0.05) (Table 6). The differences between the means of IL-4 production against catalase epitopes and recombinant catalase in the infected group were significant (P < 0.05) (Table 6). Therefore, according to the current study results, epitopes in patients induce the humoral immune system less than the recombinant catalase. Higher amounts of humoral immune response indicate that a further part of immune system is assigned to humoral responses. Since the confrontation of patients with contracted H. pylori and its catalase enzyme have memory cells in their immune system; therefore, production of IL-4 is higher when they encounter the whole catalase enzyme.
Despite the fact that the healthy individuals had no H. pylori infection (there were no memory cells), they had a similar production rate of IFN-γ. Therefore, epitopes, in spite of their short length, conduct the immune system toward the cellular immune system similar to the recombinant catalase and are even more effective. Some studies state that protection against H. pylori infection is independent of IL-4 but is mediated by predominant Th1-type immune responses (IFN-γ) (15, 30-34). Some of them even believed that IgA antibodies impair resistance against H. pylori infection (35). But some studies believed that Th2 responses with representation of IL-4 secretion interfere with H. pylori infection. Some studies demonstrated that patients infected by parasites show low incidence of H. pylori infection (36-38). Also some researchers showed that equivalent Th1-Th2 responses may have important role in protection against H. pylori infection (1). But whether Th1 or Th2 type immune responses are responsible for the protective immunity is still in distinctive.
The current study results were in accordance with the studies that mentioned Th1 responses are predominant against H. pylori. It is interesting to note that a short sequence of catalase epitopes (32 amino acids) could cause a significant response (more than 50% positive responses and even better than a whole catalase) in the studied population (22 individuals). Since more than 50% of the positive cellular immune responses of the assayed subjects to the peptide in cell proliferation, ELISpot tests, and predominant IFN-γ response, it is suggest that the predicted epitopes of catalase H. pylori are efficient antigens for protection. To study H. pylori epitopes effects better, they can serve as a composition of different H. pylori antigens epitopes. These studies can help control H. pylori infection, particularly in the developing countries like Iran. It is also suggested that these experiments be performed on the PBMC of a large population as an epidemiologic research.
In a study on a larger population, it is possible to obtain significant differences between the responses of the two groups (infected and healthy). For example, in the current research, seven out of eleven samples from the infected individuals in the T-cell proliferation test did not respond to epitopes, whereas only two out of eleven samples from the healthy individuals did not respond to epitopes. This could have occurred because of a previous encounter of the infected individuals with H. pylori and the activation of memory cells in both the humoral and cellular immune systems. In this case, the immune responses of the infected individuals compared to those of healthy individuals are assigned a lesser part of the immune system than the cellular immune system. Differences between the responses in 11 samples of each group were not significant, but in a larger population they may be significant. Of course, the current study was not large enough and comprehensive to conclude for vaccine comment; therefore, authors are going to continue the study in their future researches including animal models and human phases. Authors designed seven epitopes MVNKDVKQTTKKVLLQSTWFLKKFHPFDVTKIKKWVKFHFHTMQKKVKHLTNEEAKKYRADDSDYYKKY YRSLPADEK (GenBank accession number: Cat JQ361787) to study and compare the immune responses against the ones for future studies.

Footnotes

References

  • 1.
    Shi Y, Wu C, Zhou WY, Mao XH, Guo G, Zou QM. Identification of H-2d restricted Th epitopes in Urease B subunit of Helicobacter pylori. Vaccine. 2007;25(14):2583-90. [PubMed ID: 17240487]. https://doi.org/10.1016/j.vaccine.2006.12.024.
  • 2.
    Zhao W, Wu W, Xu X. Oral vaccination with liposome-encapsulated recombinant fusion peptide of urease B epitope and cholera toxin B subunit affords prophylactic and therapeutic effects against H. pylori infection in BALB/c mice. Vaccine. 2007;25(44):7664-73. [PubMed ID: 17913305].
  • 3.
    Hatzifoti C, Roussel Y, Harris AG, Wren BW, Morrow JW, Bajaj-Elliott M. Mucosal immunization with a urease B DNA vaccine induces innate and cellular immune responses against Helicobacter pylori. Helicobacter. 2006;11(2):113-22. [PubMed ID: 16579841]. https://doi.org/10.1111/j.1523-5378.2006.00385.x.
  • 4.
    Czinn SJ. Helicobacter pylori infection: detection, investigation, and management. J Pediatr. 2005;146(3 Suppl):S21-6. [PubMed ID: 15758899]. https://doi.org/10.1016/j.jpeds.2004.11.037.
  • 5.
    Li GQ, Chen MH, Zhu SL, Chen J, Jiao ZY, Chen W, et al. Therapeutic vaccination against Helicobacter pylori infection with attenuated recombinant Salmonella typhimurium urease B subunit and catalase in mice. Chinese j digestive dis. 2004;5(2):72-5. https://doi.org/10.1111/j.1443-9573.2004.00159.x.
  • 6.
    Chen M, Chen J, Liao W, Zhu S, Yu J, Leung WK, et al. Immunization with attenuated Salmonella typhimurium producing catalase in protection against gastric Helicobacter pylori infection in mice. Helicobacter. 2003;8(6):613-25. [PubMed ID: 14632677].
  • 7.
    Czinn SJ, Blanchard T. Vaccinating against Helicobacter pylori infection. Nat Rev Gastroenterol Hepatol. 2011;8(3):133-40. [PubMed ID: 21304478]. https://doi.org/10.1038/nrgastro.2011.1.
  • 8.
    Li HB, Zhang JY, He YF, Chen L, Li B, Liu KY, et al. Systemic immunization with an epitope-based vaccine elicits a Th1-biased response and provides protection against Helicobacter pylori in mice. Vaccine. 2012;31(1):120-6. [PubMed ID: 23137845]. https://doi.org/10.1016/j.vaccine.2012.10.091.
  • 9.
    Khan AM, Miotto O, Heiny AT, Salmon J, Srinivasan KN, Nascimento EJ, et al. A systematic bioinformatics approach for selection of epitope-based vaccine targets. Cell Immunol. 2006;244(2):141-7. [PubMed ID: 17434154]. https://doi.org/10.1016/j.cellimm.2007.02.005.
  • 10.
    De Groot AS, Bosma A, Chinai N, Frost J, Jesdale BM, Gonzalez MA, et al. From genome to vaccine: in silico predictions, ex vivo verification. Vaccine. 2001;19(31):4385-95. [PubMed ID: 11483263].
  • 11.
    Rashidi N, Moghim S, Fagheri J, SAFAEI HG. Catalase epitopes vaccine design for Helicobacter pylori: A bioinformatics approach. Afr J Biotech. 2011;10:8895-901.
  • 12.
    Jackson DC, CHUA B, ZENG W, editors. Totally synthetic peptide-based vaccines that target dendritic cells and induce potent antibody or CTL responses. International congress series. 2006;; Australia. Elsevier; p. 311-5.
  • 13.
    Miyashita M, Joh T, Watanabe K, Todoroki I, Seno K, Ohara H, et al. Immune responses in mice to intranasal and intracutaneous administration of a DNA vaccine encoding Helicobacter pylori-catalase. Vaccine. 2002;20(17-18):2336-42. [PubMed ID: 12009289].
  • 14.
    Radcliff FJ, Hazell SL, Kolesnikow T, Doidge C, Lee A. Catalase, a novel antigen for Helicobacter pylori vaccination. Infect Immun. 1997;65(11):4668-74. [PubMed ID: 9353048].
  • 15.
    Zhou WY, Shi Y, Wu C, Zhang WJ, Mao XH, Guo G, et al. Therapeutic efficacy of a multi-epitope vaccine against Helicobacter pylori infection in BALB/c mice model. Vaccine. 2009;27(36):5013-9. [PubMed ID: 19446591]. https://doi.org/10.1016/j.vaccine.2009.05.009.
  • 16.
    Torres J, Perez-Perez G, Goodman KJ, Atherton JC, Gold BD, Harris PR, et al. A comprehensive review of the natural history of Helicobacter pylori infection in children. Arch Med Res. 2000;31(5):431-69. [PubMed ID: 11179581].
  • 17.
    De Groot AS, Bishop EA, Khan B, Lally M, Marcon L, Franco J, et al. Engineering immunogenic consensus T helper epitopes for a cross-clade HIV vaccine. Methods. 2004;34(4):476-87. [PubMed ID: 15542374]. https://doi.org/10.1016/j.ymeth.2004.06.003.
  • 18.
    Dubois A, Boren T. Helicobacter pylori is invasive and it may be a facultative intracellular organism. Cell Microbiol. 2007;9(5):1108-16. [PubMed ID: 17388791]. https://doi.org/10.1111/j.1462-5822.2007.00921.x.
  • 19.
    Chu YT, Wang YH, Wu JJ, Lei HY. Invasion and multiplication of Helicobacter pylori in gastric epithelial cells and implications for antibiotic resistance. Infect Immun. 2010;78(10):4157-65. [PubMed ID: 20696835]. https://doi.org/10.1128/IAI.00524-10.
  • 20.
    Safaei HG,, Rashidi N:. Comparison of Salivary Anti Helicobacter pylori IgG with Serum IgG and Bacterio-logical Tests in Detecting Helicobacter pylori Infections. J Res Med Sci. 2005;1:1-5.
  • 21.
    Poddar U, Yachha SK. Helicobacter pylori in children: an Indian perspective. Indian Pediatr. 2007;44(10):761-70. [PubMed ID: 17998576].
  • 22.
    Hardin FJ, Wright RA. Helicobacter pylori: review and update. Hosp Physician. 2002;38(5):23-31.
  • 23.
    Suzuki T, Iwasaki E, Tsuchimoto KH, Nishizawa T, Masaoka T, Mori M. Helicobacter pylori infection and gastric cancer. J M A. 2009;14:497.
  • 24.
    Aebischer T, Walduck A, Schroeder J, Wehrens A, Chijioke O, Schreiber S, et al. A vaccine against Helicobacter pylori: towards understanding the mechanism of protection. Int J Med Microbiol. 2008;298(1-2):161-8. [PubMed ID: 17702653]. https://doi.org/10.1016/j.ijmm.2007.07.009.
  • 25.
    Arnold IC, Hitzler I, Engler D, Oertli M, Agger EM, Muller A. The C-terminally encoded, MHC class II-restricted T cell antigenicity of the Helicobacter pylori virulence factor CagA promotes gastric preneoplasia. J Immunol. 2011;186(11):6165-72. [PubMed ID: 21518972]. https://doi.org/10.4049/jimmunol.1003472.
  • 26.
    Go MF. Review article: natural history and epidemiology of Helicobacter pylori infection. Aliment Pharmacol Ther. 2002;16 Suppl 1:3-15. [PubMed ID: 11849122].
  • 27.
    Alvandi A, Farajzadeh A, Ghaforian BM, Jelodar A, Aryan E, Gholipour A, et al. Periplasmic expression and one-step purification of urease subunit B of Helicobacter pylori. W J Microbiol Biotech. https://doi.org/10.1007/s11274-010-0540-2.
  • 28.
    Del Giudice G, Michetti P. Inflammation, immunity and vaccines for Helicobacter pylori. Helicobacter. 2004;9 Suppl 1:23-8. [PubMed ID: 15347302]. https://doi.org/10.1111/j.1083-4389.2004.00245.x.
  • 29.
    Li Y, Ning YS, Wang YD, Luo J, Wang W, Dong WQ, et al. Production of mouse monoclonal antibodies against Helicobacter pylori Catalase and mapping the antigenic epitope by phage display library. Vaccine. 2008;26(9):1263-9. [PubMed ID: 18241959]. https://doi.org/10.1016/j.vaccine.2007.11.055.
  • 30.
    Kusters JG, van Vliet AH, Kuipers EJ. Pathogenesis of Helicobacter pylori infection. Clin Microbiol Rev. 2006;19(3):449-90. [PubMed ID: 16847081]. https://doi.org/10.1128/CMR.00054-05.
  • 31.
    Rizos K, Lattemann CT, Bumann D, Meyer TF, Aebischer T. Autodisplay: efficacious surface exposure of antigenic UreA fragments from Helicobacter pylori in Salmonella vaccine strains. Infect Immun. 2003;71(11):6320-8. [PubMed ID: 14573651].
  • 32.
    Moss SF, Moise L, Lee DS, Kim W, Zhang S, Lee J, et al. HelicoVax: epitope-based therapeutic Helicobacter pylori vaccination in a mouse model. Vaccine. 2011;29(11):2085-91. [PubMed ID: 21236233]. https://doi.org/10.1016/j.vaccine.2010.12.130.
  • 33.
    Moise L, McMurry JA, Pappo J, Lee DS, Moss SF, Martin WD, et al. Identification of genome-derived vaccine candidates conserved between human and mouse-adapted strains of H. pylori. Hum Vaccin. 2008;4(3):219-23. [PubMed ID: 18376134].
  • 34.
    Prinz C, Hafsi N, Voland P. Helicobacter pylori virulence factors and the host immune response: implications for therapeutic vaccination. Trends in microbiol. 2003;11(3):134-8. https://doi.org/10.1016/S0966-842X(03)00024-6.
  • 35.
    Akhiani AA, Stensson A, Schon K, Lycke NY. IgA antibodies impair resistance against Helicobacter pylori infection: studies on immune evasion in IL-10-deficient mice. J Immunol. 2005;174(12):8144-53. [PubMed ID: 15944323].
  • 36.
    Fernando N, Holton J, Zulu I, Vaira D, Mwaba P, Kelly P. Helicobacter pylori infection in an urban African population. J Clin Microbiol. 2001;39(4):1323-7. [PubMed ID: 11283050]. https://doi.org/10.1128/JCM.39.4.1323-1327.2001.
  • 37.
    Ek C, Whary MT, Ihrig M, Bravo LE, Correa P, Fox JG. Serologic evidence that ascaris and toxoplasma infections impact inflammatory responses to Helicobacter pylori in Colombians. Helicobacter. 2012;17(2):107-15. [PubMed ID: 22404440]. https://doi.org/10.1111/j.1523-5378.2011.00916.x.
  • 38.
    Whary MT, Sundina N, Bravo LE, Correa P, Quinones F, Caro F, et al. Intestinal helminthiasis in Colombian children promotes a Th2 response to Helicobacter pylori: possible implications for gastric carcinogenesis. Cancer Epidemiol Biomarkers Prev. 2005;14(6):1464-9. [PubMed ID: 15941957]. https://doi.org/10.1158/1055-9965.EPI-05-0095.

Crossmark
Crossmark
Checking
Share on
Cited by
Metrics

Purchasing Reprints

  • Copyright Clearance Center (CCC) handles bulk orders for article reprints for Brieflands. To place an order for reprints, please click here (   https://www.copyright.com/landing/reprintsinquiryform/ ). Clicking this link will bring you to a CCC request form where you can provide the details of your order. Once complete, please click the ‘Submit Request’ button and CCC’s Reprints Services team will generate a quote for your review.
Search Relations

Author(s):

Related Articles